Property Summary

NCBI Gene PubMed Count 102
PubMed Score 126.25
PubTator Score 105.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
chronic lymphocytic leukemia 1.302 2.4e-04
Multiple myeloma 1.027 4.7e-02
malignant mesothelioma 2.000 1.0e-07
non-small cell lung cancer -1.280 2.8e-19
fibroadenoma -1.200 7.2e-03
lung adenocarcinoma -1.100 4.4e-07
ductal carcinoma in situ -1.200 2.7e-03
invasive ductal carcinoma -1.300 1.8e-02
acute myeloid leukemia 1.300 1.8e-02

Gene RIF (79)

PMID Text
27544933 Gab2 may be involved in the onset and progression of HCC, but its expression is unable to serve as an independent prognosis factor in HCC patients.
26754532 Study shows that Gab2 is significantly upregulated in metastasis-positive colorectal cancer (CRC) tissues and suggest that it plays a vital role in regulating CRC metastasis and a potential target for diagnosis.
26617767 Grb2-associated binder 2 silencing impairs growth and migration of non-small cell lung cancer cells via PI3K-Akt signaling.
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
26354435 In colorectal cancer, miR-125b mediates PAR2-induced cancer cell migration by targeting Gab2.
26045784 Gab2 expression may play an important role in the progression of colorectal carcinoma.
25852062 Data indicate that high-grade serous ovarian carcinoma (HGSC) cell lines with high GRB2 associated binding protein 2 (GAB2) expression are more responsive to phosphatidylinositol 3-kinases (PI3K) inhibitor PF-04691502.
25598421 miR125a-5p acting as a novel Gab2 suppressor is partly down- regulated by DNA hypermethylation in glioma
24998422 Upregulations of Gab1 and Gab2 proteins associate with tumor progression of human gliomas.
24805943 Down-regulation of Gab2 has a protective function during M. tuberculosis infection, revealing a potential negative regulatory role for Gab2 in immunity to TB.
24385586 GAB2 has a role as an ovarian cancer oncogene, trnasforming immortalized ovarian and fallopian tube secretory epithelial cells
24327320 Gab2 protein expression was remarkably reduced in temporal neocortex of TLE patients
24161894 the GAB2 gene may be associated with sporadic Alzheimer's disease risk.
23724096 Gab2 may protect neurons against late-onset Alzheimer's disease.
23525328 interactions between the GAB2 and GSK3B polymorphisms and the well-established genetic factor APOE may modify the overall risk of Alzheimer disease.
23401857 results indicate that RSK directly phosphorylates Gab2 on 3 serine residues; findings show RSK-mediated Gab2 phosphorylation inhibits Shp2 recruitment, suggesting RSK mediates a negative-feedback loop that attenuates Gab2-dependent functions including cell motility
23231021 High Gab2 expression is associated with glioma.
22926523 GAB2 is a novel regulator of tumor angiogenesis in NRAS-driven melanoma
22859374 These results define a novel role for Gab2 in mediating mucin gene expression and GCH; these findings have important implications for the pathogenesis and therapy of airway inflammatory diseases.
22856364 significant association between the GAB2 gene and morphological brain differences in 755 young adult twins.(GAB2) has been shown to provide a 1.27-1.51 increased odds of developing late Alzheimer's.
22851227 these data underscore the critical roles of Gab1 and Gab2 in IL-22-mediated HaCaT cell proliferation, migration, and differentiation.
21996746 Gab2 overexpression, via activation of the PI3K-Zeb1 pathway, promotes characteristics of epithelial-to-mesenchymal transition in ovarian cancer cells
21653832 Both phosphatidylinositol (PI)-3 kinase and SH2 domain-containing protein tyrosine phosphatase (SHP)2 binding sites of Gab2 are required for mast cell degranulation and the anaphylaxis response.
21552417 over-expressed in malignant lung tissues
21285854 Our findings implicate an association between genetic variations of GAB2 and Alzheimer disease in Han Chinese
21118992 Gab2 regulates cytoskeletal organization and cell motility by regulating RhoA activation and binding to Shp2.
21108942 The findings implicate GAB2 as a susceptibility gene for late-onset Alzheimer disease in Han Chinese.
20888920 this study supports the association between the possibly protective GAB2 haplotype and the risk of late-onset Alzheimer's disease in APOEepsilon4 carriers
20888920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20634593 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20188796 GAB2 rs2373115 polymorphism was not a remarkable factor in developing Alzheimer disease among Mongolian.
20188796 Observational study of gene-disease association. (HuGE Navigator)
20087860 findings indicate that while Gab2 expression is not prognostic in breast cancer, its role in early disease evolution warrants further analysis
19924507 Our study does not find any association between the two tested SNPs and GAB2 haplotypes and risk for late-onset Alzheimer disease or any synergetic interaction between the SNPs and ApoE either.
19924507 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19881546 Our studies implicate focal amplification of GAB2 in breast carcinogenesis
19838208 a pivotal role for GAB2 and its transcriptional targets in anchorage-independent growth and breast cancer metastatic progression.
19523899 Distinct binding modes of two epitopes in GAB2 that interact with the SH3C domain of GRB2 are reported.
19509136 GAB2 amplification is critical for melanomas arising from sun-protected sites.
19342374 These studies demonstrate a previously undefined role for Gab2 in melanoma tumor progression and metastasis
19276544 possible role of GAB2 as an independent risk factor for Alzheimer's disease
19276544 Observational study of gene-disease association. (HuGE Navigator)
19262956 GAB2 gene has been proposed as a modifying factor of APOE epsilon 4 allele in Alzheimer's disease
19262956 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19233262 These results underscore the non-redundant and essential roles of Gab1 and Gab2 in endothelial cells, and suggest major contributions of these proteins during in vivo angiogenesis.
19204163 GAB2 contains genetic variants that may lead to a modest change in the risk for Alzheimer disease.
19204163 Observational study of gene-disease association. (HuGE Navigator)
19172738 model where signal attenuation occurs because 14-3-3 promotes dissociation of Gab2 from Grb2, and thereby uncouples Gab2 from the receptor complex
19118819 This study found GAB2 to be associated with Alzheimer's disease. Furthermore, the meta-analysis also suggests that GAB2 modifies the risk of Alzheimer's disease in APOEepsilon4 carriers.
18854865 Results show that GAB2 may not be a disease susceptibility gene for LOAD in Japanese.
18854865 Observational study of gene-disease association. (HuGE Navigator)
18853460 These data independently replicate an association between GAB2 and late-onset Alzheimer dementia, which appears to be limited to APOE epsilon4 carriers.
18853460 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18697750 activation of PI3K by c-Kit is dependent both on the direct PI3K-binding site in c-Kit and on the phosphorylation of Gab2.
18644434 These results identify a novel signaling pathway involving Jak2-dependent Gab2 phosphorylation leading to Erk1/2 activation and cell proliferation in response to granulocyte colony-stimulating factor.
18314909 In an ovarian carcinoma cohort, RSF1 was amplified in 16% of the cases. It was correlated with serous histology. The 11q13 amplicon in ovarian cancer is likely driven by a cassette of genes rather than by a single oncogene.
18272374 The GAB2 gene is at best a minor genetic determinant of AD.
18272374 Observational study of gene-disease association. (HuGE Navigator)
18235045 Lyn activation is BCR-ABL independent, it is complexed with the Gab2 and c-Cbl adapter/scaffold proteins, and it mediates persistent Gab2 and BCR-ABL tyrosine phosphorylation in the presence or absence of imatinib.
17998934 While Gab2 co-operates with overexpressed c-Src to enhance proliferative signaling, co-expression of Gab2 with activated Src mutants promotes acinar disruption.
17553421 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17553421 Our findings suggest that GAB2 modifies LOAD risk in APOE epsilon4 carriers and influences Alzheimer's neuropathology.
16736498 GAB2 is a novel target of 11q amplification in acute myeloid leukemia and myelodysplastic syndrome.
16369543 GAB2 may play a role in development of breast cancer
16253990 role for Gab2 in mammary tumorigenesis
15952937 Gab2 plays a pivotal role in the EGF-induced ERK activation pathway and that it can complement the function of Gab1 in the EGF signalling pathway; Gab1 and Gab2 are critical signalling threshold proteins for ERK activation by EGF.
15750601 We show that Gab2 has a crucial role in the differentiation of human progenitor cells into osteoclasts.
15356145 Serine residue 623 of Gab2 is a phosphorylation target for MAP kinase (ERK), with demonstrated biochemical consequences on activation of ERK itself and on activation of STAT5.
15010462 Hck-mediated phosphorylation of Gab1 and Gab2 docking proteins in IL-6-induced proliferation and survival of multiple myeloma cells.
14687710 over-expression of GRB2 and FLICE2 in RA synovium is caused by TNF-alpha inducibility differentially regulated in RA synoviocytes and provide potential pathogenic roles of these genes in the hyperplasia of the RA synovium.
12140767 The docking protein Gab2 is overexpressed and estrogen regulated in human breast cancer.
11830491 GAB2 is the limiting component of the GAB2-SHP2 complex, signaling Erk MAP kinase activation and terminal differentiation of K562 CML cells.
11701952 comparative FISH mapping of Gab1 and Gab2 genes in human, mouse and rat

AA Sequence

MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRIINLNFCEQVD      1 - 70
AGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQAEESTDSLRNVSSAGHGPRS     71 - 140
SPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSAS    141 - 210
FSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKG    211 - 280
SLTGSETDNEDVYTFKTPSNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIA    281 - 350
PPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG    351 - 420
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGAHHFDSLG    421 - 490
YPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSS    491 - 560
SQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKP    561 - 630
STSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL                            631 - 676
//

Text Mined References (108)

PMID Year Title
27544933 2016 Expression Pattern and Clinical Significance of Gab2 Protein in Hepatocellular Carcinoma.
26754532 2016 Gab2 facilitates epithelial-to-mesenchymal transition via the MEK/ERK/MMP signaling in colorectal cancer.
26617767 2015 Grb2-associated binder 2 silencing impairs growth and migration of H1975 cells via modulation of PI3K-Akt signaling.
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
26354435 2015 Proteinase-activated receptor 2 promotes cancer cell migration through RNA methylation-mediated repression of miR-125b.
26045784 2015 Gab2 is a novel prognostic factor for colorectal cancer patients.
25852062 2015 Enhanced GAB2 Expression Is Associated with Improved Survival in High-Grade Serous Ovarian Cancer and Sensitivity to PI3K Inhibition.
25598421 2016 MiR125a-5p acting as a novel Gab2 suppressor inhibits invasion of glioma.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24998422 2014 Combined detection of Gab1 and Gab2 expression predicts clinical outcome of patients with glioma.
24805943 2014 Growth factor receptor bound protein 2-associated binder 2, a scaffolding adaptor protein, negatively regulates host immunity against tuberculosis.
24385586 2014 In vivo multiplexed interrogation of amplified genes identifies GAB2 as an ovarian cancer oncogene.
24327320 2014 Decreased expression of Gab2 in patients with temporal lobe epilepsy and pilocarpine-induced rat model.
24161894 2013 GAB2 polymorphism rs2373115 confers susceptibility to sporadic Alzheimer's disease.
23724096 2013 Linking protective GAB2 variants, increased cortical GAB2 expression and decreased Alzheimer's disease pathology.
23525328 2013 Single-nucleotide polymorphisms of GSK3B, GAB2 and SORL1 in late-onset Alzheimer's disease: interactions with the APOE genotype.
23401857 2013 Gab2 phosphorylation by RSK inhibits Shp2 recruitment and cell motility.
23231021 2013 Gab2 expression in glioma and its implications for tumor invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926523 2013 GAB2 induces tumor angiogenesis in NRAS-driven melanoma.
22859374 2012 Docking protein Gab2 regulates mucin expression and goblet cell hyperplasia through TYK2/STAT6 pathway.
22856364 2012 Alzheimer's disease risk gene, GAB2, is associated with regional brain volume differences in 755 young healthy twins.
22851227 2012 Participation of Gab1 and Gab2 in IL-22-mediated keratinocyte proliferation, migration, and differentiation.
21996746 2012 Gab2 regulates the migratory behaviors and E-cadherin expression via activation of the PI3K pathway in ovarian cancer cells.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21653832 2011 Gab2, via PI-3K, regulates ARF1 in Fc?RI-mediated granule translocation and mast cell degranulation.
21552417 2011 Overexpression of Grb2-associated binder 2 in human lung cancer.
21285854 Association study of the GAB2 gene with the risk of Alzheimer disease in the chinese population.
21269460 2011 Initial characterization of the human central proteome.
21118992 2011 Gab2 regulates cytoskeletal organization and migration of mammary epithelial cells by modulating RhoA activation.
21108942 2011 Common variant in GAB2 is associated with late-onset Alzheimer's disease in Han Chinese.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20936779 2010 A human MAP kinase interactome.
20888920 2011 Association between GAB2 haplotype and higher glucose metabolism in Alzheimer's disease-affected brain regions in cognitively normal APOE?4 carriers.
20634593 2010 Validating predicted biological effects of Alzheimer's disease associated SNPs using CSF biomarker levels.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20188796 2010 Association analysis between polymorphism rs2373115 of gene GRB-associated binding protein 2 and Mongolian Alzheimer patients.
20087860 2010 Overexpression of the oncogenic signal transducer Gab2 occurs early in breast cancer development.
19924507 2010 GAB2 is not associated with late-onset Alzheimer's disease in Chinese Han.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19881546 2010 Focal amplification and oncogene dependency of GAB2 in breast cancer.
19838208 2009 The GAB2 signaling scaffold promotes anchorage independence and drives a transcriptional response associated with metastatic progression of breast cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19523899 2009 Distinct binding modes of two epitopes in Gab2 that interact with the SH3C domain of Grb2.
19509136 2009 GAB2 amplifications refine molecular classification of melanoma.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19342374 2009 Gab2-mediated signaling promotes melanoma metastasis.
19276544 2009 Implication of GAB2 gene polymorphism in Italian patients with Alzheimer's disease.
19262956 2009 GAB2 gene does not modify the risk of Alzheimer's disease in Spanish APOE 4 carriers.
19233262 2009 Non-redundant roles of the Gab1 and Gab2 scaffolding adapters in VEGF-mediated signalling, migration, and survival of endothelial cells.
19204163 2009 GAB2 as an Alzheimer disease susceptibility gene: follow-up of genomewide association results.
19172738 2008 Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein.
19118819 2009 The GAB2 gene and the risk of Alzheimer's disease: replication and meta-analysis.
18854865 2009 GAB2 is not associated with late-onset Alzheimer's disease in Japanese.
18853460 2009 Common variation in GRB-associated Binding Protein 2 (GAB2) and increased risk for Alzheimer dementia.
18697750 2008 Gab2 is involved in differential phosphoinositide 3-kinase signaling by two splice forms of c-Kit.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644434 2008 G-CSF stimulates Jak2-dependent Gab2 phosphorylation leading to Erk1/2 activation and cell proliferation.
18314909 2008 Amplification of 11q13 in ovarian carcinoma.
18272374 2008 Association study of the GAB2 gene with the risk of developing Alzheimer's disease.
18235045 2008 Lyn regulates BCR-ABL and Gab2 tyrosine phosphorylation and c-Cbl protein stability in imatinib-resistant chronic myelogenous leukemia cells.
17998934 2008 Gab2 and Src co-operate in human mammary epithelial cells to promote growth factor independence and disruption of acinar morphogenesis.
17553421 2007 GAB2 alleles modify Alzheimer's risk in APOE epsilon4 carriers.
16736498 2006 GAB2 is a novel target of 11q amplification in AML/MDS.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16369543 2006 A role for the scaffolding adapter GAB2 in breast cancer.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16253990 2006 Increased proliferation and altered growth factor dependence of human mammary epithelial cells overexpressing the Gab2 docking protein.
16219545 2005 Intrinsic regulation of the interactions between the SH3 domain of p85 subunit of phosphatidylinositol-3 kinase and the protein network of BCR/ABL oncogenic tyrosine kinase.
15952937 2005 Participation of both Gab1 and Gab2 in the activation of the ERK/MAPK pathway by epidermal growth factor.
15750601 2005 The molecular scaffold Gab2 is a crucial component of RANK signaling and osteoclastogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356145 2004 Phosphorylation of Grb2-associated binder 2 on serine 623 by ERK MAPK regulates its association with the phosphatase SHP-2 and decreases STAT5 activation.
15170389 2004 Interaction of the tyrosine phosphatase SHP-2 with Gab2 regulates Rho-dependent activation of the c-fos serum response element by interleukin-2.
15010462 2004 Critical role for hematopoietic cell kinase (Hck)-mediated phosphorylation of Gab1 and Gab2 docking proteins in interleukin 6-induced proliferation and survival of multiple myeloma cells.
14687710 2003 Regulation of GRB2 and FLICE2 expression by TNF-alpha in rheumatoid synovium.
12819203 2003 GC-GAP, a Rho family GTPase-activating protein that interacts with signaling adapters Gab1 and Gab2.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135708 2002 Phosphatidylinositol 3-kinase regulates glycosylphosphatidylinositol hydrolysis through PLC-gamma(2) activation in erythropoietin-stimulated cells.
12008033 2002 BCR mediated signal transduction in immature and mature B cells.
11997510 2002 Induced expression and association of the Mona/Gads adapter and Gab3 scaffolding protein during monocyte/macrophage differentiation.
11971018 2002 The adapter molecule Gab2 regulates Fc epsilon RI-mediated signal transduction in mast cells.
11895767 2002 Role of the docking protein Gab2 in beta(1)-integrin signaling pathway-mediated hematopoietic cell adhesion and migration.
11882361 2002 The lymphoid protein tyrosine phosphatase Lyp interacts with the adaptor molecule Grb2 and functions as a negative regulator of T-cell activation.
11830491 2002 Regulation of the Erk2-Elk1 signaling pathway and megakaryocytic differentiation of Bcr-Abl(+) K562 leukemic cells by Gab2.
11812650 2002 Molecular interactions of SHP1 and SHP2 in IL-3-signalling.
11782427 2002 PKB-mediated negative feedback tightly regulates mitogenic signalling via Gab2.
11701952 2001 Comparative FISH mapping of Gab1 and Gab2 genes in human, mouse and rat.
11572860 2001 Docking protein Gab2 is phosphorylated by ZAP-70 and negatively regulates T cell receptor signaling by recruitment of inhibitory molecules.
11466412 2001 Nerve growth factor activates persistent Rap1 signaling in endosomes.
11402314 2001 Role of Gab proteins in phosphatidylinositol 3-kinase activation by thrombopoietin (Tpo).
11334882 2001 A yeast two-hybrid study of human p97/Gab2 interactions with its SH2 domain-containing binding partners.
11287610 2001 Scaffolding protein Gab2 mediates differentiation signaling downstream of Fms receptor tyrosine kinase.
10913131 2000 Identification of an atypical Grb2 carboxyl-terminal SH3 domain binding site in Gab docking proteins reveals Grb2-dependent and -independent recruitment of Gab1 to receptor tyrosine kinases.
10752981 2000 Gab-family adapter molecules in signal transduction of cytokine and growth factor receptors, and T and B cell antigen receptors.
10704825 2000 Shc associates with the IL-3 receptor beta subunit, SHIP and Gab2 following IL-3 stimulation. Contribution of Shc PTB and SH2 domains.
10455108 1999 Engagement of Gab1 and Gab2 in erythropoietin signaling.
10391903 1999 Gab2, a new pleckstrin homology domain-containing adapter protein, acts to uncouple signaling from ERK kinase to Elk-1.
10068651 1999 Gab-family adapter proteins act downstream of cytokine and growth factor receptors and T- and B-cell antigen receptors.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.