Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.34
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Gilbert syndrome 3 3.754 1.9

Gene RIF (1)

PMID Text
20837016 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKISTTQIERRFEISSSLVGLIDGSFEIGNLFVIVFVSYFGSKLHRPKLIGIGCFLMGTGSILMALPHFF      1 - 70
MGYYRYSKETNIDPSENSTSNLPNCLINQMLSLNRTPSEIIERGCVKESGSHMWIYVFMGNMLRGIGETP     71 - 140
IVPLGISYIDDFAKEGHSSLYLGTVNVMGMTGLVFAFMLGSLFAKMYVDIGYVDLSTIRITPKDSRWVGA    141 - 210
WWLGFLVSGIVSIISSIPFFFLPLNPNKPQKERKVSLFLHVLKTNDKRNQIANLTNRRKYITKNVTGFFQ    211 - 280
SLKSILTNPLYVIFVIFTLLHMSSYIASLTYIIKMVEQQYGWSASKTNFLLGVLALPAVAIGMFSGGYII    281 - 350
KKFKLSLVGLAKLAFCSATVHLLSQVLYFFLICESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDE    351 - 420
SQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVY    421 - 490
FVIQVLDAFLCAVGLTSYSVLVIRIVQPELKALAIGFHSMIMRSLGGILVPIYFGALIDTTCMKWSTNSC    491 - 560
GARGACRIYNSTYLGRAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLEFLNDS    561 - 630
EHFVPSAEEQ                                                                631 - 640
//

Text Mined References (2)

PMID Year Title
20837016 2010 Loci from a genome-wide analysis of bilirubin levels are associated with gallstone risk and composition.
16541075 2006 The finished DNA sequence of human chromosome 12.