Property Summary

NCBI Gene PubMed Count 37
PubMed Score 54.65
PubTator Score 42.23

Knowledge Summary

Patent (5,487)

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 1.800 4.1e-02
osteosarcoma 2.144 1.6e-05
chronic lymphosyte leukemia 1.100 6.2e-04
lung cancer 2.300 6.6e-06
active Crohn's disease 1.472 9.0e-03
interstitial cystitis -1.300 7.0e-05
atypical teratoid/rhabdoid tumor 1.400 6.6e-04
pilocytic astrocytoma -1.100 1.3e-05
lung carcinoma 2.600 1.1e-27
Breast cancer -2.100 3.5e-10
ductal carcinoma in situ 1.400 3.7e-02
acute myeloid leukemia -1.900 2.0e-02
pituitary cancer 1.200 2.8e-03

Gene RIF (25)

PMID Text
25813877 seven-transmembrane domain receptors Celsr3 and Fzd3, in particular, control the development of most longitudinal tracts in the central nervous system. [Review]
25131656 DNA methylation aberrations rather than polymorphisms of FZD3 gene increase the risk of spina bifida in a high-risk region for neural tube defects.
24991956 FZD3 signaling sensitized peripheral sensory neurons in pain hypersensitivity.
24816679 Our analysis showed no significant association between the rs2241802 polymorphism in FZD3 gene and neural tube defects
24815018 Wnt3a/Frizzled-3 signaling plays important role in regulating the proliferation and differentiation of neural crest cells and various developmental stages of melanocyte precursors.
24796881 Aberrant methylation modification of the FZD3 gene increases the risk of congenital hydrocephalus by altering chromatin structure and disturbing gene expression.
24255701 clinical significance of frizzled homolog 3 protein in colorectal cancer patients
22027177 Genetic variants of the FZD3 gene may affect susceptibility to schizophrenia in Chinese Han and Va populations.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19054571 Observational study of gene-disease association. (HuGE Navigator)
18702828 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18584117 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18212053 Fzd3 is expressed in Ewing sarcoma family tumor cell lines. Fzd3 mediated Wnt-3a-dependent neurite outgrowth.
17982906 Observational study of gene-disease association. (HuGE Navigator)
17982906 In German patients, neither single markers nor haplotypes in FZD3 were associated with schizophrenia. Further exploratory analyses using a different diagnostic approach did also not yield significant results.
16707163 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15657645 Observational study of gene-disease association. (HuGE Navigator)
15657645 The FZD3 gene does not play a role in conferring susceptibility to schizophrenia variants in a Japanese sample.
15364045 Observational study of gene-disease association. (HuGE Navigator)
15274031 Observational study of gene-disease association. (HuGE Navigator)
15274031 Results suggested that the FZD3 gene might be involved in the predisposition to schizophrenia.
14642436 Observational study of gene-disease association. (HuGE Navigator)
14642436 This study found a significant association between schizophrenia and the FZD3 gene in single nucleotide polymorphisms and haplotype analyses.

AA Sequence

MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVN      1 - 70
LDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRL     71 - 140
VDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLIS    141 - 210
IICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQG    211 - 280
SHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMN    281 - 350
KIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR    351 - 420
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIV    421 - 490
GIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHA    491 - 560
SSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLN    561 - 630
EQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA                                      631 - 666
//

Text Mined References (39)

PMID Year Title
25813877 2015 Celsr3 and Fzd3 in axon guidance.
25131656 2015 DNA methylation aberrations rather than polymorphisms of FZD3 gene increase the risk of spina bifida in a high-risk region for neural tube defects.
24991956 2014 Wnt-Fzd signaling sensitizes peripheral sensory neurons via distinct noncanonical pathways.
24816679 2014 Polymorphisms in FZD3 and FZD6 genes and risk of neural tube defects in a northern Han Chinese population.
24815018 2014 The roles of Frizzled-3 and Wnt3a on melanocyte development: in vitro studies on neural crest cells and melanocyte precursor cell lines.
24796881 2014 Impaired methylation modifications of FZD3 alter chromatin accessibility and are involved in congenital hydrocephalus pathogenesis.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24255701 2013 Clinical significance of frizzled homolog 3 protein in colorectal cancer patients.
22045688 2012 FZD6 is a novel gene for human neural tube defects.
22027177 2011 Association study of the frizzled 3 gene with Chinese Va schizophrenia.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20802536 2011 Direct interaction between NHERF1 and Frizzled regulates ?-catenin signaling.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20206998 2010 Expression profile of WNT, FZD and sFRP genes in human hematopoietic cells.
19388021 2009 Sequence requirement and subtype specificity in the high-affinity interaction between human frizzled and dishevelled proteins.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
19038973 2009 Identification of WNT/beta-CATENIN signaling pathway components in human cumulus cells.
18702828 2008 The Frizzled 3 gene is associated with methamphetamine psychosis in the Japanese population.
18584117 2008 Two-stage designs to identify the effects of SNP combinations on complex diseases.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18256285 2008 The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling.
18212053 2008 Wnt-3a and Dickkopf-1 stimulate neurite outgrowth in Ewing tumor cells via a Frizzled3- and c-Jun N-terminal kinase-dependent mechanism.
17982906 2007 FZD3 is not a risk gene for schizophrenia: a case-control study in a Caucasian sample.
16707163 2006 Investigation of genetic association between human Frizzled homolog 3 gene (FZD3) and schizophrenia: results in a Korean population and evidence from meta-analysis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15657645 2005 Association study of the frizzled-3 (FZD3) gene with schizophrenia and mood disorders.
15364045 2004 Genetic and expression analyses of FZD3 in schizophrenia.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15274031 2004 Positive association of the human frizzled 3 (FZD3) gene haplotype with schizophrenia in Chinese Han population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14642436 2003 The human frizzled-3 (FZD3) gene on chromosome 8p21, a receptor gene for Wnt ligands, is associated with the susceptibility to schizophrenia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011974 2002 GIPC gene family (Review).
11407985 2001 Characterization of mouse Frizzled-3 expression in hair follicle development and identification of the human homolog in keratinocytes.
10873558 2000 Identification, gene structure, and expression of human frizzled-3 (FZD3).
10777673 2000 Molecular cloning and genomic structure of human frizzled-3 at chromosome 8p21.
10491302 1999 Identification of a Wnt-responsive signal transduction pathway in primary endothelial cells.
9192640 1997 Purification and molecular cloning of a secreted, Frizzled-related antagonist of Wnt action.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.