Property Summary

NCBI Gene PubMed Count 43
PubMed Score 74.25
PubTator Score 33.16

Knowledge Summary

Patent (9,908)

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.200 1.9e-02
psoriasis -1.200 6.7e-08
osteosarcoma 1.494 1.7e-02
ependymoma 1.400 1.0e-04
group 3 medulloblastoma 4.300 8.1e-06
atypical teratoid / rhabdoid tumor 2.800 3.0e-05
glioblastoma 1.900 1.4e-04
medulloblastoma, large-cell 1.900 3.9e-04
tuberculosis 1.200 8.5e-05
interstitial cystitis -1.500 2.0e-02
non primary Sjogren syndrome sicca 1.200 1.8e-02
non-inflammatory breast cancer -1.500 3.4e-03
ovarian cancer 2.100 3.9e-03

Gene RIF (25)

PMID Text
25369469 FZD1 expression was down-regulated by AP2 expression and mediated osteoblast differentiation and mineralization.
25197350 Our study suggests that Sox9 siRNA inhibits the proliferation capability of human osteosarcoma cells by down-regulating the expression of Wnt1 and its receptor Fzd1
24814288 our data demonstrate that FZD1 regulates PKCdelta, and the PKCdelta/AP-1 signalling transduction pathway plays an important role in drug resistance in MES-SA/Dx5 cells.
24386373 Polymorphisms in several genes involved in the Wnt signaling pathway were associated with hepatic fibrosis or inflammation risk in HCV-infected males.
23921915 ACE2 and FZD1 are prognosis markers in squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder.
23806799 Experiments demonstrate a role of E2F1 in osteoblast differentiation and mineralization and suggest that FZD1 is required, in part, for E2F1 regulation of osteoblast mineralization.
23442549 Fz1 is a Wnt responsive gene in colon-derived tissues. Fz1 expression exhibited increased expression in normal mucosa only in close proximity to colon cancer
22484497 FZD1 appears to mediate multidrug resistance by regulating the Wnt/beta-catenin pathway
22303445 Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20139419 The expression of frizzled class receptor 1 (FZD1) gene is upregulated in both Jurkat-Tat101 and Jurkat-Tat72 cells
20051274 These results suggest that FZD1 expression is regulated in a haplotype-dependent manner in osteoblasts and that these same haplotypes may be associated with biomechanical indices of bone strength.
20051274 Observational study of gene-disease association. (HuGE Navigator)
19543507 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19421142 RNA samples from 21 neuroblastoma showed a highly significant FZD1 and/or MDR1 overexpression after treatment, underlining a role for FZD1-mediated Wnt/beta-catenin pathway in clinical chemoresistance.
19148501 The proportion of frizzled-1 positive ovaries was lower in normal patients than in those with ovarian cancer or bening neoplasia
18715140 a cis-regulatory polymorphism in the FZD1 promoter region may have a functional role in determining bone structural geometry
18715140 Observational study of gene-disease association. (HuGE Navigator)
18382662 a frizzled module in cell surface collagen 18 inhibits Wnt/beta-catenin signaling
17895994 Data demonstrate that Frizzled receptors can functionally replace mating factor receptors in yeast and offer an experimental system to study modulators of Frizzled receptors.
17496152 FZD1 links epithelial/mesenchymal disruption to idiopathic pulmonary fibrosis.
16442268 Bone morphogenetic protein-2 modulates Wnt and frizzled expression and enhances the canonical pathway of Wnt signaling in normal keratinocytes
15252441 subcellular Fz localization, through the association with other membrane proteins, is a critical aspect in regulating the signaling specificity within the Wnt/Fz signaling pathways
14739301 Fz1 and LRP1 bind, which disrupts the receptor/coreceptor complex formation and leads to the repression of the canonical Wnt signaling

AA Sequence

MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLWLLEAPLLLGV      1 - 70
RAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGH     71 - 140
TNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWP    141 - 210
DTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRAL    211 - 280
KVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSY    281 - 350
PERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW    351 - 420
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGF    421 - 490
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQA    491 - 560
FRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSW    561 - 630
RKFYTRLTNSKQGETTV                                                         631 - 647
//

Text Mined References (43)

PMID Year Title
25369469 2015 AP2 suppresses osteoblast differentiation and mineralization through down-regulation of Frizzled-1.
25197350 2014 Sox9 regulates hyperexpression of Wnt1 and Fzd1 in human osteosarcoma tissues and cells.
24814288 2014 FZD1 activates protein kinase C delta-mediated drug-resistance in multidrug-resistant MES-SA/Dx5 cancer cells.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24386373 2013 WNT signaling pathway gene polymorphisms and risk of hepatic fibrosis and inflammation in HCV-infected patients.
23921915 2014 ACE2 and FZD1 are prognosis markers in squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder.
23806799 2013 E2F1 effects on osteoblast differentiation and mineralization are mediated through up-regulation of frizzled-1.
23461676 2013 Uncovering novel actors in astrocyte-neuron crosstalk in Parkinson's disease: the Wnt/?-catenin signaling cascade as the common final pathway for neuroprotection and self-repair.
23442549 2013 Invasive colon cancer, but not non-invasive adenomas induce a gradient effect of Wnt pathway receptor frizzled 1 (Fz1) expression in the tumor microenvironment.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22484497 2012 Interference of Frizzled 1 (FZD1) reverses multidrug resistance in breast cancer cells through the Wnt/?-catenin pathway.
22303445 2012 Inhibition of Wnt/?-catenin signaling by a soluble collagen-derived frizzled domain interacting with Wnt3a and the receptors frizzled 1 and 8.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20051274 2010 Functional and association analysis of frizzled 1 (FZD1) promoter haplotypes with femoral neck geometry.
20039315 2010 Wnt3-frizzled 1 chimera as a model to study canonical Wnt signaling.
19643732 2009 A coated vesicle-associated kinase of 104 kDa (CVAK104) induces lysosomal degradation of frizzled 5 (Fzd5).
19543507 2009 Non-association between polymorphisms of the frizzled receptor genes and bone mineral density in postmenopausal Korean women.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19421142 2009 The Wnt receptor FZD1 mediates chemoresistance in neuroblastoma through activation of the Wnt/beta-catenin pathway.
19388021 2009 Sequence requirement and subtype specificity in the high-affinity interaction between human frizzled and dishevelled proteins.
19277043 2009 Secreted Frizzled-related protein-1 is a negative regulator of androgen receptor activity in prostate cancer.
19188438 2009 Myocilin is a modulator of Wnt signaling.
19148501 2009 Canonical and noncanonical Wnt pathway: a comparison among normal ovary, benign ovarian tumor and ovarian cancer.
18929644 2009 Stably overexpressed human Frizzled-2 signals through the beta-catenin pathway and does not activate Ca2+-mobilization in Human Embryonic Kidney 293 cells.
18715140 2009 Functional characterization of genetic variation in the Frizzled 1 (FZD1) promoter and association with bone phenotypes: more to the LRP5 story?
18382662 2008 A cryptic frizzled module in cell surface collagen 18 inhibits Wnt/beta-catenin signaling.
17895994 2007 Signaling of human frizzled receptors to the mating pathway in yeast.
17496152 2007 Genomic profile of matrix and vasculature remodeling in TGF-alpha induced pulmonary fibrosis.
16442268 2006 Bone morphogenetic protein-2 modulates Wnt and frizzled expression and enhances the canonical pathway of Wnt signaling in normal keratinocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15370539 2004 Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
15252441 2004 Subcellular localization of frizzled receptors, mediated by their cytoplasmic tails, regulates signaling pathway specificity.
14739301 2004 The low density lipoprotein receptor-1, LRP1, interacts with the human frizzled-1 (HFz1) and down-regulates the canonical Wnt signaling pathway.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067714 2002 Direct interaction of Frizzled-1, -2, -4, and -7 with PDZ domains of PSD-95.
12012019 2002 The Frizzled-1/(beta(2))-adrenergic receptor chimera: pharmacological properties of a unique G protein-linked receptor.
11433302 2001 Novel mechanism of Wnt signalling inhibition mediated by Dickkopf-1 interaction with LRP6/Arrow.
10557084 1999 Human frizzled 1 interacts with transforming Wnts to transduce a TCF dependent transcriptional response.
9813155 1998 Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7.
9707618 1998 A novel frizzled gene identified in human esophageal carcinoma mediates APC/beta-catenin signals.