Property Summary

Ligand Count 4
NCBI Gene PubMed Count 37
PubMed Score 59.74
PubTator Score 44.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Leukocyte adhesion deficiency 16 3.287 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
diabetes mellitus 1.100 1.0e-03
esophageal adenocarcinoma -1.700 3.3e-02
medulloblastoma, large-cell 1.100 4.1e-05
nephrosclerosis -1.161 3.6e-03
osteosarcoma 1.053 2.7e-04
ovarian cancer 1.400 1.5e-13
pancreatic cancer 1.300 3.0e-04
psoriasis 1.600 1.1e-04
spina bifida -1.849 4.1e-02

Gene RIF (16)

AA Sequence

MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWP      1 - 70
FNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPS     71 - 140
HCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQ    141 - 210
SLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNY    211 - 280
ERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQ    281 - 350
TRGIAAWFT                                                                 351 - 359
//

Text Mined References (40)

PMID Year Title