1. Home
  2. Targets
  3. transferase
  4. glycosyltransferase
  5. Alpha-(1,3)-fucosyltransferase 6

Tchem Alpha-(1,3)-fucosyltransferase 6

Enzyme involved in the biosynthesis of the E-Selectin ligand, sialyl-Lewis X. Catalyzes the transfer of fucose from GDP-beta-fucose to alpha-2,3 sialylated substrates.

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 33
PubMed Score 56.40
PubTator Score 44.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Leukocyte adhesion deficiency 15 3.302 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.161 3.6e-03
esophageal adenocarcinoma -1.700 3.3e-02
psoriasis 1.800 2.1e-04
osteosarcoma 1.729 5.0e-07
medulloblastoma, large-cell 1.100 4.1e-05
pancreatic cancer 1.300 3.0e-04
diabetes mellitus 1.100 1.0e-03
spina bifida -1.849 4.1e-02
ovarian cancer 1.500 5.9e-12

Synonym

Accession P51993 A6NEX0 D6W637 Q9UND8
Symbols FT1A
FCT3A
Fuc-TVI
FucT-VI

Gene

FUT6

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 UniProt Keyword (12)

See all...

 GO Function (3)

 GO Component (5)

 GO Process (3)

 Compartment GO Term (36)

See all...

 GWAS Trait (4)

 HCA RNA Cell Line (46)

See all...

Pathway (4)

Ligand (4)

Structure of CHEMBL611881

CHEMBL611881
pKi 6.05

Structure of CHEMBL610390

CHEMBL610390
pKi 6.29

Structure of CHEMBL610391

CHEMBL610391
pKi 6.36

Structure of CHEMBL610389

CHEMBL610389
pKi 6.43

Gene RIF (13)

PMID Text
25962326 The T allele of rs3760776 might repress the transcription of the FUT6 gene.
24953560 In normal colon samples a significant relationship between sLe(x) expression and the ratio between FUT6/B4GALNT2 activities exists, demonstrating for the first time a role for B4GALNT2 in sLe(x) inhibition in vivo
24232099 Results suggest that FUT4-, FUT6- or FUT8-mediated MDR in human HCC is associated with the activation of the PI3K/Akt pathway and the expression of MRP1.
22155250 these results suggest that FUT6 plays an important role in hepatocellular carcinoma growth by regulating the PI3K/Akt signaling pathway.
20965272 The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20179215 GALNT14 and FUT3/6 H-scores were significantly higher in non-small cell lung cancer cell lines sensitive to dulanermin and drozitumab versus resistant cell lines
19913121 Observational study of gene-disease association. (HuGE Navigator)
19349624 results suggested that PKR is the primary target for HSV-1 early RNA during induction of FUT3, FUT5, and FUT6
18274891 two defined regions in the 5'-flanking region of the FUT VI transcription start site are critical for FUT VI transcription in HepG2 cells
17054948 IL-1 beta-induced sLeX expression on HuH-7 cells was suppressed by transfection of gene-specific small interference RNAs against FUT VI and ST3Gal IV but not against FUT IV and ST3Gal III.
14514715 5'UT-exons A or C have higher expression of FUT8 transcripts and higher alpha6-fucosyltransferase activity
12670495 endo-beta-galactosidase-sensitive and mAb FH6-reactive carbohydrate chains are generated under the control of expression levels of FUT6 and involved in the adhesion of colon carcinoma cells to liver sections.

AA Sequence 

MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWP      1 - 70
FNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPS     71 - 140
HCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQ    141 - 210
SLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNY    211 - 280
ERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQ    281 - 350
TRGIAAWFT                                                                 351 - 359
//

Text Mined References (35)

PMID Year Title
25962326 2015 Transcriptional Downregulation by Nucleotide Substitution with the Minor Allele of rs3760776 Located in the Promoter of FUT6 Gene.
24953560 2014 B4GALNT2 gene expression controls the biosynthesis of Sda and sialyl Lewis X antigens in healthy and cancer human gastrointestinal tract.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24232099 2013 FUT family mediates the multidrug resistance of human hepatocellular carcinoma via the PI3K/Akt signaling pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
22155250 2012 Functional analysis of ?1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
20965272 2011 The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20179215 2010 Development of immunohistochemistry assays to assess GALNT14 and FUT3/6 in clinical trials of dulanermin and drozitumab.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19349624 2009 Activation of host antiviral RNA-sensing factors necessary for herpes simplex virus type 1-activated transcription of host cell fucosyltransferase genes FUT3, FUT5, and FUT6 and subsequent expression of sLe(x) in virus-infected cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18274891 2008 Transcriptional regulation of the fucosyltransferase VI gene in hepatocellular carcinoma cells.
17054948 2006 Interleukin-1beta induces sialyl Lewis X on hepatocellular carcinoma HuH-7 cells via enhanced expression of ST3Gal IV and FUT VI gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14514715 2004 Activity and tissue distribution of splice variants of alpha6-fucosyltransferase in human embryogenesis.
12670495 2003 Expression levels of FUT6 gene transfected into human colon carcinoma cells switch two sialyl-Lewis X-related carbohydrate antigens with distinct properties in cell adhesion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11530205 2001 Neutrophils promote the release of alpha-6-fucosyltransferase from blood platelets through the action of cathepsin G and elastase.
11102976 2000 Identification of two functionally deficient plasma alpha 3-fucosyltransferase (FUT6) alleles.
10900002 2000 Localization of alpha 1,3-fucosyltransferase VI in Weibel-Palade bodies of human endothelial cells.
10536043 1999 alpha1,3Fucosyltransferase VI is expressed in HepG2 cells and codistributed with beta1,4galactosyltransferase I in the golgi apparatus and monensin-induced swollen vesicles.
8175676 1994 Molecular basis for plasma alpha(1,3)-fucosyltransferase gene deficiency (FUT6).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7782074 1995 Physical maps of human alpha (1,3)fucosyltransferase genes FUT3-FUT6 on chromosomes 19p13.3 and 11q21.
7656588 1995 Relative positions of two clusters of human alpha-L-fucosyltransferases in 19q (FUT1-FUT2) and 19p (FUT6-FUT3-FUT5) within the microsatellite genetic map of chromosome 19.
7650030 1995 Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms.
1520296 1992 The cloning and expression of a human alpha-1,3 fucosyltransferase capable of forming the E-selectin ligand.
1339443 1992 Molecular cloning of a fourth member of a human alpha (1,3)fucosyltransferase gene family. Multiple homologous sequences that determine expression of the Lewis x, sialyl Lewis x, and difucosyl sialyl Lewis x epitopes.