Property Summary

NCBI Gene PubMed Count 55
PubMed Score 113.00
PubTator Score 224.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.400 3.9e-07
psoriasis 1.500 8.4e-126
osteosarcoma -5.673 1.1e-13
posterior fossa group A ependymoma -1.300 1.2e-08
atypical teratoid / rhabdoid tumor -1.200 6.6e-05
glioblastoma -1.200 6.9e-04
medulloblastoma -1.100 2.3e-04
primary pancreatic ductal adenocarcinoma -1.511 1.8e-04
intraductal papillary-mucinous adenoma (... -2.200 6.4e-04
intraductal papillary-mucinous carcinoma... -1.900 3.8e-03
lung cancer -1.500 3.8e-03
pediatric high grade glioma -1.100 3.8e-04
pilocytic astrocytoma -1.200 1.1e-04
lung adenocarcinoma -1.066 3.2e-09
pancreatic cancer -1.400 2.1e-04

 OMIM Phenotype (1)

Gene RIF (32)

PMID Text
25761312 data confirm the hypothesis that the h2 allele is linked to Se(357, 716), and the concurrence of unique FUT1 and FUT2 mutations is geographically specific.
25297588 Data indicate that alpha -1,2 fucosyltransferase (FUT1) 682A> G and 547_552delAG mutations do not affect the transcript efficiency, although various mutations have different impact on the enzyme's activity.
25239830 FUT1 mediates c-Jun-induced cell proliferation in ovarian cancer cells.c-Jun transcriptionally modulates FUT1 expression in ovarian cancer cells.
25101798 Data indicate that single nucleotide polymorphism (SNPS) in the 3'-untranslated region of the fucosyltransferase 1 (FUT1) gene and intron of the syntaxin 1B (STX1B) gene were the top hits for Kawasaki disease (KD) susceptibility.
24665114 Fut1 plays an important role in regulating angiogenesis and ICAM-1 expression in inflammatory arthritis.
24593306 FUT1-specific fucosidase diminishes the activation of beta1 integrin.
24527852 Three new alleles in FUT1 and FUT2 genes were identified in the study. The allelic polymorphisms of FUT1 and FUT2 in Tibetans show a population-specific manner.
24467809 We show that fut1 in RA synovial fibroblasts is important in angiogenesis, leukocyte-synovial fibroblast adhesion, and synovial fibroblast proliferation
23533340 FUT1 mRNA expression in DLD-1 cells is transcriptionally regulated by Elk-1.
23063462 anti-H could accommodate grafts through triggering apoptosis and down-regulating Fut1 expression to reduce ABH antigens
22161108 FUT1 allele 547-548delAG deletion and 658C>T missense mutation in part form the molecular basis of para-Bombay blood types.
22082156 Knockdown of fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group; FUT1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22053055 Macrophage-derived factors including LIF might facilitate development of an implantation-receptive endometrium by regulating surface glycan structures in epithelial cells by up-regulating FUT1 and FUT2.
21983725 mutations of FUT1 gene did not affect the RNA and protein expression levels, but the enzyme activity of cells with FUT1 mutations was significantly decreased which resulted in the reduced expressin of H antigen.
21839020 In summary, two novel non-functional FUT1 alleles (FUT1 649T and FUT1 35T, 423A) were identifi ed in para-Bombay individuals
20506485 Data show that si-RNA induced down-regulation of FUT1 and FUT2 reduced expression of fucosylated nucleolin glycoforms and their exposure at the cell surface.
19572973 Multiple common and sporadic sequence variations including 14 new alleles at FUT1, FUT2, and FUT3 loci were identified.
19137814 The findings indicate that alpha1,2-FT have the ability to enhance the proliferation and elevate the survival rates of RMG-I cells, which can promote the genesis and development of ovarian carcinoma.
18686606 The transfection of alpha1, 2-FT gene can increase the activity of alpha1, 2-FT in the cell line RMG-I and mainly increase the expression of Lewis y antigen simultaneously.
18374127 Expression of this human enzyme on porcine chondrocytes protects them from both humoral and cellular rejection.
18205178 These observations point to a tumor induced transcription of endothelial FUT1 and consequently an enhanced expression of CD174 which is involved in migration and early cell-cell contacts during tumor associated angiogenesis.
18155296 Aberrant expression of a single glycosyltransferase can profoundly affect thymopoiesis, although the relative involvement of CD45-dependent and -independent mechanisms is yet to be determined.
18023290 Suppressing the expression of FUT1/4 by RNAi technology reduces the synthesis of LeY and inhibits cancer growth.
17922418 Molecular genetic analysis of FUT1 and FUT2 gene was performed for seven Chinese Han individuals serologically typed as para-Bombay.
17459061 Expression of FUT1 induces changes in metastatic capacity of HT-29/M3 colon cancer cells, as a consequence of the altered expression pattern of type 2 Lewis antigens.
16331565 Data show that the C35T substitution of FUT1 gene is not a mutation which gives rise to a non-functional h allele responsible for para-Bombay phenotype but a single nucleotide polymorphism in Chinese population.
16331565 Observational study of genotype prevalence. (HuGE Navigator)
15847661 A novel nonfunctional FUT1 allele C293T was identified in a person with the para-Bombay phenotype.
15487706 Observational study of genotype prevalence. (HuGE Navigator)
15476160 Four kinds of known h alleles (h1-h4), 2 kinds of novel non-functional FUT1 alleles, a Se(w) allele, and a novel SeG716A polymorphism in Chinese para-Bombay individuals were detected.
12697902 identification of an essential component of notch signaling pathways
12652076 FUT1 catalyses the addition of alpha-1,2-fucose to MUC1 and MUC5AC apomucins

AA Sequence

MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSC      1 - 70
PQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTP     71 - 140
WRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDR    141 - 210
PRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVT    211 - 280
FAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWV    281 - 350
GINADLSPLWTLAKP                                                           351 - 365
//

Text Mined References (55)

PMID Year Title
25761312 2015 Genomic analysis of para-Bombay individuals in south-eastern China: the possibility of linkage and disequilibrium between FUT1 and FUT2.
25297588 2014 [Effect of ? -1,2 fucosyltransferase gene 682A> G and 547_552delAG mutations on the activity of fucosyltransferase].
25239830 2014 c-Jun transcriptionally regulates alpha 1, 2-fucosyltransferase 1 (FUT1) in ovarian cancer.
25101798 2014 High-density genotyping of immune loci in Kawasaki disease and IVIG treatment response in European-American case-parent trio study.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24665114 2015 A key role for Fut1-regulated angiogenesis and ICAM-1 expression in K/BxN arthritis.
24593306 2014 Calreticulin activates ?1 integrin via fucosylation by fucosyltransferase 1 in J82 human bladder cancer cells.
24527852 2014 Sequence analysis of the human fucosyltransferase 1 and 2 genes in Tibetan blood donors: identification of three novel alleles.
24467809 2014 Fucosyltransferase 1 mediates angiogenesis, cell adhesion and rheumatoid arthritis synovial tissue fibroblast proliferation.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23533340 2013 Transcriptional regulation of fucosyltransferase 1 gene expression in colon cancer cells.
23372041 2013 Novel locus including FGF21 is associated with dietary macronutrient intake.
23063462 2012 Anti-H can trigger apoptosis and down-regulate FUT1 expression in erythroid differentiated K562 cells without complement mediation.
22161108 2011 [Mutational analysis for FUT1 gene in two cases with para-Bombay blood type].
22053055 2012 Macrophages regulate expression of ?1,2-fucosyltransferase genes in human endometrial epithelial cells.
21983725 2011 [Study on the expression stability of mutant alpha-1,2 fucosyltransferase gene 293C to T and 658C to T in eukaryotic cells].
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21839020 2011 Molecular genetic analysis for the para-Bombay blood group revealing two novel alleles in the FUT1 gene.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
20506485 2010 RNA-mediated gene silencing of FUT1 and FUT2 influences expression and activities of bovine and human fucosylated nucleolin and inhibits cell adhesion and proliferation.
19572973 2009 Identification of 14 new alleles at the fucosyltransferase 1, 2, and 3 loci in Styrian blood donors, Austria.
19137814 2008 [alpha1,2-fucosyltransferase gene transfection influences on biological behavior of ovarian carcinoma-derived RMG-I cells].
18686606 2008 [Transfection of alpha1, 2-fucosyltransferase gene increases the antigenic expression of Lewis y in ovarian cancer cell line RMG-I].
18374127 2008 Characterization of cartilage from H-transferase transgenic pigs.
18205178 2008 Involvement of alpha 1-2-fucosyltransferase I (FUT1) and surface-expressed Lewis(y) (CD174) in first endothelial cell-cell contacts during angiogenesis.
18155296 2008 Glycosylation changes in hFUT1 transgenic mice increase TCR signaling and apoptosis resulting in thymocyte maturation arrest.
18023290 2008 Suppression of FUT1/FUT4 expression by siRNA inhibits tumor growth.
17922418 2007 [Molecular genetic analysis of FUT1 and FUT2 gene in para-Bombay Chinese: a novel FUT1 allele is identified].
17459061 2007 Changes in the invasive and metastatic capacities of HT-29/M3 cells induced by the expression of fucosyltransferase 1.
16331565 2005 [Study on the frequency of alpha-1,2-fucosyltransferase gene h4 allele (C35T) in Chinese population].
15847661 2005 Molecular basis for para-Bombay phenotypes in Chinese persons, including a novel nonfunctional FUT1 allele.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15487706 2004 Two prevalent h alleles in para-Bombay haplotypes among 250,000 Taiwanese.
15476160 2004 [Analysis on FUT1 and FUT2 gene of 10 para-Bombay individuals in China].
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12697902 2003 Protein O-fucosyltransferase 1 is an essential component of Notch signaling pathways.
12652076 2002 The expression of human FUT1 in HT-29/M3 colon cancer cells instructs the glycosylation of MUC1 and MUC5AC apomucins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12366770 2002 Molecular genetic analysis of para-Bombay phenotypes in Chinese: a novel non-functional FUT1 allele is identified.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
10330445 1999 Identification of a novel major histocompatibility complex class II-restricted tumor antigen resulting from a chromosomal rearrangement recognized by CD4(+) T cells.
9760178 1998 Changing transcription start sites in H-type alpha(1,2)fucosyltransferase gene (FUT1) during differentiation of the human erythroid lineage.
9745152 1998 Point mutations and deletion responsible for the Bombay H null and the Reunion H weak blood groups.
9556663 1985 The presence of at least two different H-blood-group-related beta-D-gal alpha-2-L-fucosyltransferases in human serum and the genetics of blood group H substances.
9299444 1997 Missense mutation of FUT1 and deletion of FUT2 are responsible for Indian Bombay phenotype of ABO blood group system.
9226185 1997 Wide variety of point mutations in the H gene of Bombay and para-Bombay individuals that inactivate H enzyme.
9122901 1997 Polymorphism of the h allele and the population frequency of sporadic nonfunctional alleles.
9054453 1997 Structure and expression of H-type GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase gene (FUT1). Two transcription start sites and alternative splicing generate several forms of FUT1 mRNA.
7912436 1994 Molecular basis for H blood group deficiency in Bombay (Oh) and para-Bombay individuals.
7768954 1995 Chaperone function of a Grp 94-related protein for folding and transport of the pancreatic bile salt-dependent lipase.
7656588 1995 Relative positions of two clusters of human alpha-L-fucosyltransferases in 19q (FUT1-FUT2) and 19p (FUT6-FUT3-FUT5) within the microsatellite genetic map of chromosome 19.
7246545 1981 A new genetic model proposing that the Se gene is a structural gene closely linked to the H gene.
6177241 1982 Distribution of H type 1 and H type 2 antigenic determinants in human sera and saliva.
2118655 1990 Molecular cloning, sequence, and expression of a human GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase cDNA that can form the H blood group antigen.
1763885 1991 The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9.