Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.64
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.504 2.7e-03
tuberculosis 1.200 2.1e-06

Gene RIF (1)

AA Sequence

MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDT      1 - 70
YVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGN     71 - 140
LILRKGVLALNPLL                                                            141 - 154
//

Text Mined References (9)

PMID Year Title