Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma multiforme 1.100 7.2e-18
osteosarcoma 1.837 1.2e-08
juvenile dermatomyositis 1.050 1.7e-13
acute quadriplegic myopathy 1.212 1.6e-07
primary pancreatic ductal adenocarcinoma 1.024 1.5e-02
breast carcinoma 1.400 2.9e-03
pilocytic astrocytoma 1.200 2.2e-06
ovarian cancer 1.400 4.1e-03

Synonym

Accession Q9BZ67 B4E2P1 Q86V56 Q8NCB5
Symbols FKSG44

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDI      1 - 70
ALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIH     71 - 140
DEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQ    141 - 210
SLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPA    211 - 280
QGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKL    281 - 350
LKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTI    351 - 420
DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG                              421 - 464
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.