Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.86
PubTator Score 2.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
oligodendroglioma -1.800 1.2e-02
glioblastoma -2.400 6.2e-03
osteosarcoma -2.787 4.5e-11
posterior fossa group B ependymoma -2.600 2.0e-06
atypical teratoid / rhabdoid tumor -2.800 1.4e-05
medulloblastoma, large-cell -2.600 3.3e-02
primitive neuroectodermal tumor -2.700 6.1e-03
pediatric high grade glioma -1.800 2.9e-02
pilocytic astrocytoma -2.100 4.0e-03
sonic hedgehog group medulloblastoma -2.200 2.8e-02
ovarian cancer -1.100 3.7e-07
psoriasis 1.600 2.8e-10

Gene RIF (1)

PMID Text
22337703 The combined effect of the EHD3 and FREM3 genes may play an important role in developing major depressive disorder.

AA Sequence

MAGASRHPTGTPRQLLVALACLLLSRPALQGRASSLGTEPDPALYLPARGALDGTRPDGPSVLIANPGLR      1 - 70
VPLGRSLWLDPLRDLVIGVQPGDRCEVTVLDALPRLKGALSPRRFPCTFGPRQVQYTHFGSHSPGRARVL     71 - 140
LQLRYDAPTHTLVLPFTLAVDLVFSQLELVTRNRPLVVEKLRSWSRAIDRRVLDFASLKSGATATRRCRL    141 - 210
TPLPHEDGPLPKYGRLVDAVGAPLPRGKGVDCEAFLRAGVRYQHTATSSPNRDYVPMMVELLGPEGQDAG    211 - 280
SAGVLVREHFQLLVRIRGGAENTPPRPSFMATMMMEVDPLVLTALTPDALAAEDVESDPGDLVFNILNAP    281 - 350
THPPGHPGQQGYVVSTDDPLGLPVSFFTQQELRELKIAYQPPAENSHGERLFQLELEVVDGDGAASDPFA    351 - 420
FMVTVKSMNTLVPVASHNRGLVLFEGQSRPLSSTHSIPISDKDNLEEVKMAAVRGLRHGQLVVFGAPAGC    421 - 490
KYFTPADLAAGRVVYQHDGSNTYSDNIIFRMEDGHHQVDFLFPLTILPVDDEPPMVNTNTGLSLTEGQVV    491 - 560
QISPFVLSATDIDSEDSTIHFVLENQPLKGNEEEPQWELAPGSSHSGHYLGDLLLQQAELPLSTEDEDWH    561 - 630
YMEKEGLYEKVVTEWLQRDIMEGRLFYRHLGPHSPQSVMVQLAFHVQDDHDPPNLSKQHIFTIKVQPVDI    631 - 700
LSPQLYPGTTLEMTVQEYQLTHFQKNFLRYIDQDSDDQNLWYTLLTLPTDTDGNHQVRAGEIVLTDSPDT    701 - 770
LIMHFTQAQVNQHKVAYQPPQKLGIAPRVVQFTYQVEDAAGNSVPGTFTLFLQPVDNQPPEVTNRGFAIL    771 - 840
EGGSFNLSSNELHVTDPDTDIDQIVFILVRGPQHGHLQYFKRCMVPGESFMQADVINGSVSYQHGRDQTT    841 - 910
TSDTFHLEVSDGVHHIPITIPISVHPNVANRSPRISLRSSSLLDVSIDVLENKATEITMGVIHGKRKDVG    911 - 980
DLMLSFIVKDSPKLGTILVNGLPTERFTQEDLINGRVAYAHTAGEVGFQKQHDAFSLILSKDSYQWVVGN    981 - 1050
SIIEKVQVQVTVLPVDNVGPKVFVGESFIVYEGEKNSLTLQHLHVEDVDTHQDELLCTVTSQPASGYLEK   1051 - 1120
IASAPGSKMSQSGSPISAFSLRDIQVRHINYVQSIHKGVEPQEDQFTFYCSDGINFSPNVFFPIIILPTN   1121 - 1190
DEQPKLFAHEFKVLEGMSLVIDTQLLNGADADLPPNELHFQLTALPRHGRIIQQLATGSQPIHSFTLKEI   1191 - 1260
QEASTIVYEHDDSETKEDSFEVWLSDGKHTTHRKVPIVVTLVDDETPHLTVNNGLKVEKGHSEIITNRIL   1261 - 1330
KATDLDSDDKSLSFVLHSGPQQGLLQRLRKPRGEVRNNLTLGMNFTQDEINRGLICYIHTGQEGIVDIIK   1331 - 1400
FDVTDGVNTLTDHYFYVTIGNLDSVFPEVISKRITLIEGARVTLTNNLLTNSDINSSDEHHFSITRAPSL   1401 - 1470
GHLESSDYAGEPIASFTQLQLASNKISYVHTSNDEKKMDSFEFQVIGELYPVFRTFRIFITDVDNKKPIL   1471 - 1540
TIHRLTLQKEDSQLITLLELTVEDSDTPDDLILFTITQVPMHGKILYNGSRPVTTFTKQDLNKNLISYKH   1541 - 1610
DGSETTEDSFSLTVTDGTHTDFYVLPDTALATHKPQVMRVQIRSLDNRLPQITTNRGAPALKRLHTGHMG   1611 - 1680
FLITSKSLKAEDQDSPHRLLKYKVTRGPEHGFIIKTGLGNQSTRVFTQADIDEMKISYVLNEGSNASKDI   1681 - 1750
FYFSVEDNGGNKLTNQPFHLNWAWICLEKEYYIVDEDSTFLEVTLTRRGYLGETSFISIGTKDETAKKDK   1751 - 1820
DFKWKTNKQIQFNPGQTTATWRVRIIPDNEYETSETFQIILSEPLMAVLEFPEMATVEIVDPGDESTVYI   1821 - 1890
PEAEYKIEEDIGELLIPVRRSGDASQELIVICSTRQGSATGTISSTVLFSDYISRPEDHTSILHFDKNET   1891 - 1960
QKTCQVLIIDDSLYEEEESFSVSLRLPVGGQLGARFPTTKVTILADRYDEPVLHFGDAEYHVNESARYVE   1961 - 2030
VCVWRRGTDLSQPSSIAVRSRKSEQESAEAGTDYVGISRNLDFAPGVRMQTFQVTILDDLGQPTLEGPEK   2031 - 2100
FELLLQMPMGAVLGEPNKTTIFIEDTITDCKQSACSSFD                                  2101 - 2139
//

Text Mined References (6)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22337703 2012 A study of the combined effects of the EHD3 and FREM3 genes in patients with major depressive disorder.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
18661360 2008 The Fras1/Frem family of extracellular matrix proteins: structure, function, and association with Fraser syndrome and the mouse bleb phenotype.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15345741 2004 The extracellular matrix gene Frem1 is essential for the normal adhesion of the embryonic epidermis.