Property Summary

NCBI Gene PubMed Count 115
PubMed Score 311.39
PubTator Score 240.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.1
Disease Target Count Z-score Confidence
Crohn's disease 311 0.0 0.9
Disease Target Count
Speech-Language Disorder 1 1

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.500 4.4e-02
astrocytoma -1.100 2.9e-06
Astrocytoma, Pilocytic -2.900 7.2e-08
atypical teratoid / rhabdoid tumor -2.100 1.1e-02
breast carcinoma -1.400 2.2e-05
chronic rhinosinusitis -1.560 4.6e-04
cystic fibrosis and chronic rhinosinusit... -1.442 8.6e-04
ductal carcinoma in situ -2.100 7.0e-05
ependymoma 1.500 2.1e-03
fibroadenoma -1.400 3.7e-03
glioblastoma -1.800 3.8e-04
group 4 medulloblastoma 1.100 8.6e-03
interstitial cystitis -1.300 3.5e-02
intraductal papillary-mucinous adenoma (... -2.100 2.2e-03
intraductal papillary-mucinous carcinoma... -2.800 5.3e-07
intraductal papillary-mucinous neoplasm ... -2.300 1.2e-03
invasive ductal carcinoma -1.455 6.1e-04
lung carcinoma -2.100 2.3e-20
medulloblastoma, large-cell 1.500 1.1e-03
oligodendroglioma -1.400 6.9e-09
ovarian cancer -2.200 1.0e-10
pancreatic ductal adenocarcinoma liver m... -1.094 7.9e-03
periodontitis -1.300 1.0e-21
ulcerative colitis -1.100 6.6e-03
urothelial carcinoma -1.900 1.3e-02

 GO Component (1)

 IMPC Phenotype (1)

Gene RIF (100)

AA Sequence

MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT      1 - 70
SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK     71 - 140
KQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKEQQQQQQQQQQL    141 - 210
AAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSME    211 - 280
DNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKW    281 - 350
PGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP    351 - 420
KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSE    421 - 490
IAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHK    491 - 560
CFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLI    561 - 630
NNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELE    631 - 700
DDREIEEEPLSEDLE                                                           701 - 715
//

Text Mined References (115)

PMID Year Title