Property Summary

NCBI Gene PubMed Count 2
PubMed Score 4.92
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.9e-43
Disease Target Count Z-score Confidence
Coloboma 52 3.35 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.9e-43

AA Sequence

MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPAPPYAAPSYGA      1 - 70
PGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYK     71 - 140
RSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRAEASAAVRSGAR    141 - 210
SVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVA    211 - 280
THAPQTLNPSPGFAPGHQTAAAGFRLSHLLYSREGTEV                                    281 - 318
//

Text Mined References (4)

PMID Year Title
16289364 2005 Cloning and analysis of the murine Foxi2 transcription factor.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.