Property Summary

NCBI Gene PubMed Count 91
PubMed Score 214.26
PubTator Score 242.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 3.2e-107
Disease Target Count Z-score Confidence
Cancer 2346 4.34 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.500 3.2e-107

Synonym

Accession P15407 B4DR11 Q6FG51 FRA-1
Symbols FRA
FRA1
fra-1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (65)

PMID Text
26975631 SIRT1 expression correlated positively with Fra-1 expression, metastasis and overall survival in patients with colorectal cancer
26646695 Our results demonstrate that Fra-1 is an important determinant of the metastatic potential of human colon cancer cells, and that the Fra-1 classifier can be used as a prognostic predictor in colon cancer patients.
26549498 Results suggest that Fra-1 is upregulated in lung cancer tissues and functions by affecting the P53 signaling pathway.
26337460 miR-195 can repress the migration and invasion of prostate cancer cells via regulating Fra-1
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
25750173 Intense immunohistochemical staining of Fra-1 was observed at the tumor marginal area adjacent to inflammatory cells and in parallel with IL-6 secretion and STAT3 activation in colorectal cancer tissues.
25666264 High Fra-1 expression significantly correlates with shorter overall survival.
25651840 Results suggested that Fra-1 expression is low in cervical cancer tissues and promotes apoptosis of cervical cancer cells by p53 signaling pathway.
25301070 Fra-1 induces critical changes in the expression of tgfb1 and Epithelial-to-mesenchymal transition transcription factors through direct binding to the tgfb1, zeb1 and zeb2 genomic regulatory regions.
25175497 Fra1 promotes the growth of HaCaT cells in vitro by arresting the cell cycle and inhibiting cell apoptosis.
24658684 FRA1 plays an important role in mediating cross talk between oncogenic RAS-ERK and TGFbeta signaling networks during tumor progression.
24652774 These results suggest that FOSL1 may be related to IgAN severity.
24604526 CD44 dysregulated the activation of the Fra1 gene. The interaction of Fra-1 and CD44 may therefore be important in cervical carcinoma.
24084233 we review the current knowledge of av and b3 transcriptional regulation in endothelial cells and discuss the role of FOSL1 in angiogenesis
23625206 Data indicate that estrogen induced the expression of c-Jun, Fra-1, c-Fos, cyclin D1 and cyclin E1 while tamoxifen (TMX) decreased the expression.
23483055 Identification of a pharmacologically tractable Fra-1/ADORA2B axis promoting breast cancer metastasis.
23301044 Fra-1 and c-Fos have roles in supporting growth of human malignant breast tumors by activating membrane biogenesis at the cytoplasm
23001043 MicroRNA-34 suppresses breast cancer invasion and metastasis by directly targeting Fra-1.
22911824 Fra-1 mediates anti-fibrotic effects in the lung through the modulation of proinflammatory, profibrotic and fibrotic gene expression.
22514348 Fra-1 was induced by Epstein-Barr virus LMP2A and is essential for LMP2A-triggered MMP9 expression.
22461694 Rhinovirus-induced MMP-9 expression is dependent on Fra-1, which is modulated by formoterol and dexamethasone.
22411068 the molecular data suggest that the functional outcome of the 11q12 rearrangements is deregulated expression of FOSL1.
22286759 PKCtheta signalling as an important regulator of Fra-1 accumulation in estrogen receptor positive breast cancer cells.
22235402 Enhanced FOSL1 expression significantly correlated with high psoriasis area and severity index. High level of FOSL1 gene expression was proposed to be a marker of pathological process activity in psoriasis.
22198213 identified Fra-1 as a new target of miR-34a and demonstrated that miR-34a inhibits Fra-1 expression at both protein and messenger RNA levels; p53 indirectly regulates Fra-1 expression via a miR-34a-dependant manner in colon cancer cells
22028113 This study demonstrated ESCC patients positive for Fra-1 to be associated with poor prognosis. The findings also suggest that Fra-1 regulation may play an important role in the progression of ESCC.
21969367 Molecular characterization of the microRNA-138-Fos-like antigen 1 (FOSL1) regulatory module in squamous cell carcinoma.
21840727 data suggest the involvement of an injury-induced Fra-1 transcription factor as a regulator of keratinocyte gene expression, which might act as an antagonistic player to restrict epithelial-driven angiogenic responses during normal skin flap integration.
21822309 study reports Fra-1 is highly expressed in the muscle-invasive form of bladder cancer and to a lesser extent in superficial bladder cancer; gene coding for AXL tyrosine kinase is directly upregulated by Fra-1 in bladder cancer and other cell lines; data demonstrate that AXL mediates the effect of Fra-1 on tumour cell motility but not on cell proliferation
21708480 study shows that YAP could promote cell proliferation by activating transcription factor Fra-1 in oral squamous cell carcinoma.
21640141 Two AP-1 components, c-Jun and Fra-1, were phosphorylated, and bound to the AP-1 binding site of the MMP-1 promoter in 143B cells.
21558934 RT-PCR showed that FOSL1 from osteoblasts from Pfeiffer syndrome grown on PLPG acid plates were upregulated after 30 days.
21526963 Activated nuclear factor kappaB and Fos-related antigen 1 are elevated in epithelial cells in lung tissues of patients with acute respiratory distress syndrome.
21460858 Fra-1 is an important mediator of interstitial lung disease following gefitinib treatment
21371080 A high frequency of Fra-1 in DCIS tumours may be associated with early events in breast carcinogenesis. Although Fra-1 expression correlated with features of a more aggressive phenotype in IDC, no relationship with overall survival was found.
21088499 FRA1 takes part in a control of architecture and migratory nature of GBM cells. It is a phosphorylated factor that transactivates JunB with which it makes effectively AP-1 pairs.
20663135 High FOSL1 is associated with melanoma.
20511396 in tumor tissue derived from highly metastatic basal-like MDA-MB231 cells, high levels of c-Jun/Fra1 complexes were detected
20353950 AP-1 (Fra-1/c-Jun)-mediated induction of expression of matrix metalloproteinase-2 is required for 15S-hydroxyeicosatetraenoic acid-induced angiogenesis
20198886 Expression of the FOSL1 gene proved to substantially increase in both psoriatic lesions of the skin and atherosclerotic lesions of vessels as compared with nonlesion samples.
19923172 Chromatin immunoprecipitation assays confirmed that JunB/Fra-1 proteins interact in vivo with the beta4-integrin promoter and that JunB/Fra-1 promoter occupancy is reduced during keratinocyte differentiation as well as in HPV8 E2 positive keratinocytes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19384981 study found surface parameters for Fra-1 are similar in general to those of c-Fos and c-Jun; differences were found in the interactions of the three proteins with phospholipids
19160107 Fra-1 might play a role in the progression and prognosis of NSCLC.
18435914 A prominent role for ERK1/2 was shown in the TPA-induced activation of c-Jun regulating the Fra1 promoter.
18288638 Data suggest that Fra-1 enhances lung cancer epithelial cell motility and invasion by inducing the activity of matrix metalloproteinases, in particular MMP-2 and MMP-9, and EGFR-activated signaling.
18172271 IL-13R alpha 2, EphA2, and Fra-1 are attractive therapeutic targets representing molecular denominators of high-grade astrocytomas. One hundred percent of GBM tumors overexpress at least one of these proteins.
18098284 In colon cells, the induction of epithelial mesenchymal transition by oncogenic Ha-RAS could occur through the overexpression of proteins like FRA-1 and vimentin.
18096084 Fra-1 is associated with cell migration in human MMs and that Fra-1 modulation of CD44 may govern migration of selected MMs.
17882273 a large multiprotein complex, which includes Fra-1, p300, P/CAF, junD, junB, and Sp1 acts at the AP1-5 site to produce a synergistic increase in hINV gene expression
17872495 Data suggest that HGF-induced effects in some mesothelioma cells are mediated via activation of a novel PI3K/ERK5/Fra-1 feedback pathway
17616677 FRA-1 can promote motility, invasion, and anchorage-independent growth of lung epithelial cells in vitro, but is insufficient for tumor formation
17572495 The activation of MMP-9 promoter is dependent upon interactions of Fra-1/c-Jun with Stat3.
17371847 Data report that the intrinsic instability of Fra-1 depends on a single destabilizer contained within the C-terminal 30 to 40 amino acids.
17192200 Overexpression of Fra-1, leading to a persistent high cytoplasmic accumulation, may play a role in the process of breast carcinogenesis.
16490785 PI3K through p21-activated kinase 1 regulates FRA-1 proto-oncogene induction by cigarette smoke and the subsequent activation of the Elk1 and cAMP-response element-binding protein transcription factors
15831677 Fra-1 may likely play an important role in the maintenance/progression of malignant gliomas
15615716 Delayed recruitment of Fra-1 to the IL-8 promoter provides an example how AP-1 subunits may dampen excessive chemokine synthesis.
15608675 Fra-1 expression is associated with a more malignant cell phenotype and suggest that Fra-1 could have a pivotal role in breast cancer progression.
13679379 cooperative interactions between factors binding to multiple cis-elements of the -379/-283 promoter region appear to regulate TPA-induced fra-1 transcription in human cells
12692267 The regulation by Akt3 was found to be due to two specific regions in the Fra-1 regulatory sequence which match Sp1 consensus sites
12209953 upregulation of cyclin D1 and Fra-1 in human colorectal adenocarcinomas is driven by abnormally expressed beta-catenin
11912197 Molecular mechanism of transforming growth factor (TGF)-beta1-induced glutathione depletion in alveolar epithelial cells. Involvement of AP-1/ARE and Fra-1.

AA Sequence

MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTY      1 - 70
PQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKL     71 - 140
EDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVL    141 - 210
EPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL             211 - 271
//

Text Mined References (94)

PMID Year Title
26975631 2016 SIRT1 promotes epithelial-mesenchymal transition and metastasis in colorectal cancer by regulating Fra-1 expression.
26646695 2015 Fra-1 is a key driver of colon cancer metastasis and a Fra-1 classifier predicts disease-free survival.
26549498 2016 Fra-1 is upregulated in lung cancer tissues and inhibits the apoptosis of lung cancer cells by the P53 signaling pathway.
26337460 2015 MicroRNA-195-5p, a new regulator of Fra-1, suppresses the migration and invasion of prostate cancer cells.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
25750173 2015 Aberrantly expressed Fra-1 by IL-6/STAT3 transactivation promotes colorectal cancer aggressiveness through epithelial-mesenchymal transition.
25666264 2015 Prognostic impact of transcription factor Fra-1 in ER-positive breast cancer: contribution to a metastatic phenotype through modulation of tumor cell adhesive properties.
25651840 2015 Fra-1 is downregulated in cervical cancer tissues and promotes cervical cancer cell apoptosis by p53 signaling pathway in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
25301070 2015 Fra-1/AP-1 induces EMT in mammary epithelial cells by modulating Zeb1/2 and TGF? expression.
25175497 2014 FOS-like antigen 1 is highly expressed in human psoriasis tissues and promotes the growth of HaCaT cells in vitro.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24658684 2014 Widespread FRA1-dependent control of mesenchymal transdifferentiation programs in colorectal cancer cells.
24652774 2014 Association of FOS-like antigen 1 promoter polymorphism with podocyte foot process effacement in immunoglobulin A nephropathy patients.
24604526 2014 CD44 affects the expression level of FOS?like antigen 1 in cervical cancer tissues.
24084233 Role of the AP-1 transcription factor FOSL1 in endothelial cells adhesion and migration.
24029232 2013 Protein kinase C ? is a central signaling node and therapeutic target for breast cancer stem cells.
23625206 2013 Effect of estrogen and tamoxifen on the expression pattern of AP-1 factors in MCF-7 cells: role of c-Jun, c-Fos, and Fra-1 in cell cycle regulation.
23483055 2013 Identification of a pharmacologically tractable Fra-1/ADORA2B axis promoting breast cancer metastasis.
23301044 2013 Old players with a newly defined function: Fra-1 and c-Fos support growth of human malignant breast tumors by activating membrane biogenesis at the cytoplasm.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23027619 2012 Transcriptional regulation of the interleukin-11 gene by oncogenic Ras.
23001043 2013 MicroRNA-34 suppresses breast cancer invasion and metastasis by directly targeting Fra-1.
22911824 2012 Fra-1/AP-1 transcription factor negatively regulates pulmonary fibrosis in vivo.
22514348 2012 Epstein-Barr virus latent membrane protein 2A promotes invasion of nasopharyngeal carcinoma cells through ERK/Fra-1-mediated induction of matrix metalloproteinase 9.
22461694 2012 Rhinovirus-induced MMP-9 expression is dependent on Fra-1, which is modulated by formoterol and dexamethasone.
22411068 2012 FOSL1 as a candidate target gene for 11q12 rearrangements in desmoplastic fibroblastoma.
22286759 2012 The PKC? pathway participates in the aberrant accumulation of Fra-1 protein in invasive ER-negative breast cancer cells.
22235402 2011 Effects of expression of transcriptional factor AP-1 FOSL1 gene on psoriatic process.
22198213 2012 MicroRNA-34a inhibits migration and invasion of colon cancer cells via targeting to Fra-1.
22028113 2012 The molecular role of Fra-1 and its prognostic significance in human esophageal squamous cell carcinoma.
21969367 2011 Molecular characterization of the microRNA-138-Fos-like antigen 1 (FOSL1) regulatory module in squamous cell carcinoma.
21840727 2012 Identification of the Fra-1 transcription factor in healing skin flaps transplants: a potential role as a negative regulator of VEGF release from keratinocytes.
21822309 2012 Fra-1 controls motility of bladder cancer cells via transcriptional upregulation of the receptor tyrosine kinase AXL.
21708480 2011 Yes-associated protein promotes cell proliferation by activating Fos Related Activator-1 in oral squamous cell carcinoma.
21673316 2011 TRPS1 targeting by miR-221/222 promotes the epithelial-to-mesenchymal transition in breast cancer.
21640141 2011 Phosphorylated c-Jun and Fra-1 induce matrix metalloproteinase-1 and thereby regulate invasion activity of 143B osteosarcoma cells.
21558934 2011 Biological effect of resorbable plates on normal osteoblasts and osteoblasts derived from Pfeiffer syndrome.
21526963 2011 Increased levels of nuclear factor ?B and Fos-related antigen 1 in lung tissues from patients with acute respiratory distress syndrome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21460858 2011 Interstitial lung disease induced by gefitinib and toll-like receptor ligands is mediated by Fra-1.
21371080 2011 Role of Fos-related antigen 1 in the progression and prognosis of ductal breast carcinoma.
21088499 2011 Fos-related antigen 1 (Fra-1) pairing with and transactivation of JunB in GBM cells.
20663135 2010 Gene expression analysis after receptor tyrosine kinase activation reveals new potential melanoma proteins.
20511396 2010 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo.
20353950 2010 AP-1 (Fra-1/c-Jun)-mediated induction of expression of matrix metalloproteinase-2 is required for 15S-hydroxyeicosatetraenoic acid-induced angiogenesis.
20198886 2010 [Expression of the FOSL1 gene in psoriasis and atherosclerosis].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19923172 2010 Human papillomavirus type 8 E2 protein unravels JunB/Fra-1 as an activator of the beta4-integrin gene in human keratinocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19384981 2009 The immediate-early oncoproteins Fra-1, c-Fos, and c-Jun have distinguishable surface behavior and interactions with phospholipids.
19160107 2009 Expression and significance of FRA-1 in non-small-cell lung cancer.
19060904 2009 An empirical framework for binary interactome mapping.
18435914 2008 ERK signaling regulates tumor promoter induced c-Jun recruitment at the Fra-1 promoter.
18288638 2008 A Fra-1-dependent, matrix metalloproteinase driven EGFR activation promotes human lung epithelial cell motility and invasion.
18172271 2008 Interleukin-13 receptor alpha 2, EphA2, and Fos-related antigen 1 as molecular denominators of high-grade astrocytomas and specific targets for combinatorial therapy.
18098284 2008 Fra-1 regulates vimentin during Ha-RAS-induced epithelial mesenchymal transition in human colon carcinoma cells.
18096084 2007 Fra-1 governs cell migration via modulation of CD44 expression in human mesotheliomas.
17882273 2008 Synergistic activation of human involucrin gene expression by Fra-1 and p300--evidence for the presence of a multiprotein complex.
17872495 2008 HGF mediates cell proliferation of human mesothelioma cells through a PI3K/MEK5/Fra-1 pathway.
17616677 2007 FRA-1 proto-oncogene induces lung epithelial cell invasion and anchorage-independent growth in vitro, but is insufficient to promote tumor growth in vivo.
17572495 2008 Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.
17371847 2007 Ubiquitin-independent proteasomal degradation of Fra-1 is antagonized by Erk1/2 pathway-mediated phosphorylation of a unique C-terminal destabilizer.
17254320 2007 FRA-1 protein overexpression is a feature of hyperplastic and neoplastic breast disorders.
17192200 2006 An association of a simultaneous nuclear and cytoplasmic localization of Fra-1 with breast malignancy.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16490785 2006 A Phosphatidylinositol 3-kinase-regulated Akt-independent signaling promotes cigarette smoke-induced FRA-1 expression.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15831677 2005 Fos-related antigen 1 modulates malignant features of glioma cells.
15615716 2005 MEK1-dependent delayed expression of Fos-related antigen-1 counteracts c-Fos and p65 NF-kappaB-mediated interleukin-8 transcription in response to cytokines or growth factors.
15608675 2005 FRA-1 expression level regulates proliferation and invasiveness of breast cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13679379 2003 Multiple cis-elements mediate the transcriptional activation of human fra-1 by 12-O-tetradecanoylphorbol-13-acetate in bronchial epithelial cells.
12692267 2003 Gene expression profiling in prostate cancer cells with Akt activation reveals Fra-1 as an Akt-inducible gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424143 2002 Role and regulation of activator protein-1 in toxicant-induced responses of the lung.
12371906 2003 A functional activating protein 1 (AP-1) site regulates matrix metalloproteinase 2 (MMP-2) transcription by cardiac cells through interactions with JunB-Fra1 and JunB-FosB heterodimers.
12209953 2002 Elevated protein expression of cyclin D1 and Fra-1 but decreased expression of c-Myc in human colorectal adenocarcinomas overexpressing beta-catenin.
11912197 2002 Molecular mechanism of transforming growth factor (TGF)-beta1-induced glutathione depletion in alveolar epithelial cells. Involvement of AP-1/ARE and Fra-1.
11708771 2001 Interaction of AP-1 with a cluster of NF-kappa B binding elements in the human TNF promoter region.
10918580 2000 Differential transcriptional regulation of the monocyte-chemoattractant protein-1 (MCP-1) gene in tumorigenic and non-tumorigenic HPV 18 positive cells: the role of the chromatin structure and AP-1 composition.
9858769 1998 Inducible and constitutive transcription factors in the mammalian nervous system: control of gene expression by Jun, Fos and Krox, and CREB/ATF proteins.
9458721 1998 Expression of fos and jun genes in human skeletal muscle after exercise.
9267807 1997 A 3-Mb contig from D11S987 to MLK3, a gene-rich region in 11q13.
9160889 1997 Cross-family interaction between the bHLHZip USF and bZip Fra1 proteins results in down-regulation of AP1 activity.
9016559 1997 Cell-type specific DNA-protein interactions at the tissue-type plasminogen activator promoter in human endothelial and HeLa cells in vivo and in vitro.
8938448 1996 Definition of the minimal MEN1 candidate area based on a 5-Mb integrated map of proximal 11q13. The European Consortium on Men1, (GENEM 1; Groupe d'Etude des Néoplasies Endocriniennes Multiples de type 1).
8276409 1993 Reverse mapping of the gene encoding the human fos-related antigen-1 (fra-1) within chromosome band 11q13.
8230424 1993 Human T-cell leukemia virus type 1 Tax activates transcription of the human fra-1 gene through multiple cis elements responsive to transmembrane signals.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2107490 1990 Isolation of human fos-related genes and their expression during monocyte-macrophage differentiation.