Property Summary

NCBI Gene PubMed Count 101
PubMed Score 235.82
PubTator Score 242.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.2e-107
Disease Target Count Z-score Confidence
Cancer 2499 4.441 2.2
Osteosclerosis 31 3.107 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.500 3.2e-107

Gene RIF (73)

AA Sequence

MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTY      1 - 70
PQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKL     71 - 140
EDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVL    141 - 210
EPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL             211 - 271
//

Text Mined References (104)

PMID Year Title