Property Summary

NCBI Gene PubMed Count 35
PubMed Score 7.43
PubTator Score 3.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Familial partial lipodystrophy 7 3.125 1.6

Expression

Gene RIF (5)

PMID Text
23643986 The results of this study show that activation in Ras signaling cascade may be implicated in the METH-induced death signaling pathway in neuroblastoma SH-SY5Y cells.
22992747 Data show that protein farnesyltransferase (FTase) specificity can be "tuned" using a small number of active site contacts that play essential roles in discriminating against non-substrates in the wild-type enzyme.
22882915 The level of FTase mRNA expression in cancer tissues is much higher than in normal tissues. FTase may play an important role in the genesis and development of PLC and may be one of the markers for the metastatic activity gained by liver tumor cells.
19841875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11751396 farnesyl:protein transferase and geranylgeranyl:protein transferase inhibitor combinations in preclinical models.

AA Sequence

MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPR      1 - 70
LVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGF     71 - 140
GGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASV    141 - 210
ASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSR    211 - 280
QMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGL    281 - 350
LDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV    351 - 420
PGFEELKDETSAEPATD                                                         421 - 437
//

Text Mined References (39)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23643986 2013 Farnesyltransferase inhibitor attenuates methamphetamine toxicity-induced Ras proteins activation and cell death in neuroblastoma SH-SY5Y cells.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22992747 2012 Expansion of protein farnesyltransferase specificity using "tunable" active site interactions: development of bioengineered prenylation pathways.
22882915 2012 Expression of farnesyltransferase in primary liver cancer.
21269460 2011 Initial characterization of the human central proteome.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19841875 2010 Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study.
19246009 2009 Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
19228685 2009 The protein farnesyltransferase regulates HDAC6 activity in a microtubule-dependent manner.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16893176 2006 Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451670 2004 Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
15248757 2004 Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.
15170324 2004 Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12825937 2003 Dual protein farnesyltransferase-geranylgeranyltransferase-I inhibitors as potential cancer chemotherapeutic agents.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374986 2002 Reaction path of protein farnesyltransferase at atomic resolution.
12036349 2002 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
11687658 2001 The crystal structure of human protein farnesyltransferase reveals the basis for inhibition by CaaX tetrapeptides and their mimetics.
11598000 2001 The helical domain of GBP-1 mediates the inhibition of endothelial cell proliferation by inflammatory cytokines.
10852915 2000 Farnesyl transferase inhibitors block the farnesylation of CENP-E and CENP-F and alter the association of CENP-E with the microtubules.
10747914 2000 Prenylation-dependent association of protein-tyrosine phosphatases PRL-1, -2, and -3 with the plasma membrane and the early endosome.
10676968 2000 Structure of human guanylate-binding protein 1 representing a unique class of GTP-binding proteins.
9657673 1998 Cocrystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate.
8910345 1996 Effect of insulin on farnesyltransferase activity in 3T3-L1 adipocytes.
8830800 1996 Prenylation of an interferon-gamma-induced GTP-binding protein: the human guanylate binding protein, huGBP1.
8599089 1996 The p21(RAS) farnesyltransferase alpha subunit in TGF-beta and activin signaling.
8494894 1993 Characterization of recombinant human farnesyl-protein transferase: cloning, expression, farnesyl diphosphate binding, and functional homology with yeast prenyl-protein transferases.
8276393 1993 cDNA cloning of the two subunits of human CAAX farnesyltransferase and chromosomal mapping of FNTA and FNTB loci and related sequences.
8175923 1994 The processing pathway of prelamin A.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2217184 1990 Identification and preliminary characterization of protein-cysteine farnesyltransferase.