Property Summary

NCBI Gene PubMed Count 33
PubMed Score 23.49
PubTator Score 13.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.494 3.6e-03
Multiple myeloma 1.017 8.6e-03
osteosarcoma 1.579 1.6e-04
diabetes mellitus 2.200 4.6e-03
acute myeloid leukemia 2.400 3.1e-02
ovarian cancer -1.400 4.3e-04
pituitary cancer -1.200 4.8e-04
Down syndrome 1.300 4.2e-04

 MGI Phenotype (1)

Gene RIF (8)

PMID Text
22160308 our findings identify Geranylgeranyl transferase 1 as a key regulator of human airway smooth muscle cell viability
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19841875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19228685 FTase, via its tubulin-association, is a critical upstream regulator of HDAC6 activity
18406652 Geranylgeranyltransferase-1 modulates both p24CA release and intracellular Gag in TNF-alpha-stimulated U1 cells
18187620 Knockdown of farnesyltransferase, CAAX box, alpha (FNTA) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17192483 Geranylgeranyltransferase inhibitor-2147 (GGTI-2147), an inhibitor of protein prenylation, elicited significant inhibition of glucose-stimulated insulin secretion from INS 832/13 islet cells.
15451670 Results suggest that all peptide substrates adopt a common binding mode in the protein farnesyltransferase and geranylgeranyltransferase active site.

AA Sequence

MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA      1 - 70
EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL     71 - 140
LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI    141 - 210
QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL    211 - 280
KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT    281 - 350
IRKEYWRYIGRSLQSKHSTENDSPTNVQQ                                             351 - 379
//

Text Mined References (42)

PMID Year Title
22160308 2012 Geranylgeranyl transferase 1 modulates autophagy and apoptosis in human airway smooth muscle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19841875 2010 Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19246009 2009 Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
19228685 2009 The protein farnesyltransferase regulates HDAC6 activity in a microtubule-dependent manner.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17192483 2007 Dominant-negative alpha-subunit of farnesyl- and geranyltransferase inhibits glucose-stimulated, but not KCl-stimulated, insulin secretion in INS 832/13 cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16893176 2006 Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451670 2004 Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
15248757 2004 Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.
15170324 2004 Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12825937 2003 Dual protein farnesyltransferase-geranylgeranyltransferase-I inhibitors as potential cancer chemotherapeutic agents.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374986 2002 Reaction path of protein farnesyltransferase at atomic resolution.
12036349 2002 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
11687658 2001 The crystal structure of human protein farnesyltransferase reveals the basis for inhibition by CaaX tetrapeptides and their mimetics.
11313965 2001 Inactivation of farnesyltransferase and geranylgeranyltransferase I by caspase-3: cleavage of the common alpha subunit during apoptosis.
10852915 2000 Farnesyl transferase inhibitors block the farnesylation of CENP-E and CENP-F and alter the association of CENP-E with the microtubules.
10747914 2000 Prenylation-dependent association of protein-tyrosine phosphatases PRL-1, -2, and -3 with the plasma membrane and the early endosome.
8910345 1996 Effect of insulin on farnesyltransferase activity in 3T3-L1 adipocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8830800 1996 Prenylation of an interferon-gamma-induced GTP-binding protein: the human guanylate binding protein, huGBP1.
8599089 1996 The p21(RAS) farnesyltransferase alpha subunit in TGF-beta and activin signaling.
8530343 1995 Interaction of the transforming growth factor-beta type I receptor with farnesyl-protein transferase-alpha.
8494894 1993 Characterization of recombinant human farnesyl-protein transferase: cloning, expression, farnesyl diphosphate binding, and functional homology with yeast prenyl-protein transferases.
8419339 1993 Mutational analysis of alpha-subunit of protein farnesyltransferase. Evidence for a catalytic role.
8276393 1993 cDNA cloning of the two subunits of human CAAX farnesyltransferase and chromosomal mapping of FNTA and FNTB loci and related sequences.
8175923 1994 The processing pathway of prelamin A.
8106351 1994 cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I.
7713879 1995 CAAX geranylgeranyl transferase transfers farnesyl as efficiently as geranylgeranyl to RhoB.
2217184 1990 Identification and preliminary characterization of protein-cysteine farnesyltransferase.
1400319 1992 Post-translational modifications of p21rho proteins.