Property Summary

NCBI Gene PubMed Count 34
PubMed Score 19.37
PubTator Score 13.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 5.487 2.7

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 2.400 3.1e-02
diabetes mellitus 1.800 3.2e-03
Down syndrome 1.300 4.2e-04
Multiple myeloma 1.017 8.6e-03
osteosarcoma 1.103 2.0e-03
ovarian cancer -1.400 4.3e-04
pituitary cancer -1.200 4.8e-04
Waldenstrons macroglobulinemia 1.494 3.6e-03

 MGI Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (9)

AA Sequence

MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA      1 - 70
EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL     71 - 140
LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI    141 - 210
QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL    211 - 280
KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT    281 - 350
IRKEYWRYIGRSLQSKHSTENDSPTNVQQ                                             351 - 379
//

Text Mined References (43)

PMID Year Title