Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.66
PubTator Score 1.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lipidoses 17 0.0 0.0
Disease Target Count
Lipoidosis 17
Disease Target Count Z-score Confidence
Fuchs' endothelial dystrophy 24 3.937 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.822 1.2e-08
group 3 medulloblastoma -1.100 2.0e-04
malignant mesothelioma -4.100 6.6e-09
medulloblastoma, large-cell -1.400 8.5e-06
osteosarcoma 1.729 5.4e-05
pancreatic ductal adenocarcinoma liver m... -1.631 5.8e-03
psoriasis 1.700 3.5e-04

Gene RIF (4)

AA Sequence

MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP      1 - 70
EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG     71 - 140
SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP    141 - 210
EQSPQGRPVGTRQKKSPSINTIDV                                                  211 - 234
//

Text Mined References (15)

PMID Year Title