Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.03
PubTator Score 19.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Chondrosarcoma 24 3.612 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.300 3.3e-02
malignant mesothelioma 2.400 6.1e-08
cutaneous lupus erythematosus 1.500 3.6e-03
osteosarcoma -2.031 4.0e-05
lung carcinoma -1.300 7.6e-21
acute myeloid leukemia 1.300 3.3e-02

Gene RIF (7)

PMID Text
23801653 FMNL1 contributes to leukemogenesis and could act in part through Rac1 regulation.
23460512 Results suggest that macrophage coiling phagocytosis is a complex process involving several actin nucleation/regulatory factors. They also point specifically to the formins mDia1 and FMNL1 as novel regulators of spirochete uptake by human immune cells.
23182705 constitutively activated form of FMNL1 (FMNL1gamma) induces localization of AHNAK1 to the cell membrane.
21148482 after Rac-dependent activation of FMNL1, srGAP2 mediates a potent mechanism to limit the duration of Rac action and inhibit formin activity during rapid actin dynamics.
20617518 Our data suggest that FRL1 is responsible for modifying actin at the macrophage podosome and may be involved in actin cytoskeleton dynamics during adhesion and migration within tissues.
19815554 Results describe N-myristoylation as a regulative mechanism of FMNL1 responsible for membrane trafficking potentially involved in a diversity of polarized processes of hematopoietic lineage-derived cells.
14592423 Western blot analysis demonstrated that the protein encoded by this gene is overexpressed in lymphoid malignancies, cancer cell lines and peripheral blood leukocyte from chronic lymphocytic leukemia (CLL) patients.

AA Sequence

MGNAAGSAEQPAGPAAPPPKQPAPPKQPMPAAGELEERFNRALNCMNLPPDKVQLLSQYDNEKKWELICD      1 - 70
QERFQVKNPPAAYIQKLKSYVDTGGVSRKVAADWMSNLGFKRRVQESTQVLRELETSLRTNHIGWVQEFL     71 - 140
NEENRGLDVLLEYLAFAQCSVTYDMESTDNGASNSEKNKPLEQSVEDLSKGPPSSVPKSRHLTIKLTPAH    141 - 210
SRKALRNSRIVSQKDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKNPRTKALVLELLAAVC    211 - 280
LVRGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVENMNFRVFLQYEF    281 - 350
THLGLDLYLERLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTERLRDAEN    351 - 420
ESMAKIAELEKQLSQARKELETLRERFSESTAMGPSRRPPEPEKAPPAAPTRPSALELKVEELEEKGLIR    421 - 490
ILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPS    491 - 560
APPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPDALGRRDSELGPGV    561 - 630
KAKKPIQTKFRMPLLNWVALKPSQITGTVFTELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSALKSKAA    631 - 700
QKAPSKATLIEANRAKNLAITLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFER    701 - 770
EQRPMEELSEEDRFMLCFSRIPRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEI    771 - 840
VLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSV    841 - 910
SLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKT    911 - 980
TSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMDLISELKRRQ    981 - 1050
QKEPLIYESDRDGAIEDIITVIKTVPFTARTGKRTSRLLCEASLGEEMPL                       1051 - 1100
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23801653 2013 FMNL1 promotes proliferation and migration of leukemia cells.
23460512 2013 The formins FMNL1 and mDia1 regulate coiling phagocytosis of Borrelia burgdorferi by primary human macrophages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23182705 2013 Proteomic investigation of the interactome of FMNL1 in hematopoietic cells unveils a role in calcium-dependent membrane plasticity.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21269460 2011 Initial characterization of the human central proteome.
21148482 2011 Bi-modal regulation of a formin by srGAP2.
20617518 2010 The formin FRL1 (FMNL1) is an essential component of macrophage podosomes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19815554 2009 Formin-like 1 (FMNL1) is regulated by N-terminal myristoylation and induces polarized membrane blebbing.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14592423 2003 Human leukocyte formin: a novel protein expressed in lymphoid malignancies and associated with Akt.
12684686 2003 Identification and characterization of human FMNL1, FMNL2 and FMNL3 genes in silico.
12632087 2003 Identification and characterization of human DAAM2 gene in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10958683 2000 FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.
9799091 1998 The NIK protein kinase and C17orf1 genes: chromosomal mapping, gene structures and mutational screening in frontotemporal dementia and parkinsonism linked to chromosome 17.
9787083 1998 Genomic structure and physical mapping of C17orf1: a gene associated with the proximal element of the CMT1A-REP binary repeat.