Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.36
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -6.500 4.9e-10
astrocytic glioma -2.000 7.7e-03
oligodendroglioma -1.500 1.8e-02
glioblastoma -1.900 7.5e-03
osteosarcoma 2.632 7.0e-03
medulloblastoma, large-cell -2.600 4.5e-04
non-small cell lung cancer -3.012 2.4e-19
intraductal papillary-mucinous adenoma (... 1.800 3.0e-02
lung cancer -4.000 4.1e-06
interstitial cystitis -1.900 4.9e-04
cystic fibrosis 1.400 1.1e-03
lung adenocarcinoma -2.500 1.8e-08
adult high grade glioma -1.500 3.2e-03
posterior fossa group A ependymoma -1.200 3.9e-03
Breast cancer -1.100 3.3e-02
lung carcinoma -3.000 2.9e-23
ulcerative colitis 1.500 8.1e-03
ovarian cancer -3.900 5.8e-09
pituitary cancer 2.600 1.9e-04

Gene RIF (3)

PMID Text
26235030 Results suggest that UNC5 and LPHN3 can simultaneously bind to FLRT3, forming a trimeric complex, and that FLRT3 may form transsynaptic complexes with both LPHN3 and UNC5.
22405201 This study demonistrated that LPHN3 and its ligand FLRT3 play an important role in glutamatergic synapse development.
18593871 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQI      1 - 70
NNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSV     71 - 140
SAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNL    141 - 210
LNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSN    211 - 280
NNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNA    281 - 350
ELFDCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS    351 - 420
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMVPMETSNLYLF    421 - 490
DETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVTIALLALVCWYVHRNGSLFS    491 - 560
RNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSES    561 - 630
SSNRSYRDSGIPDSDHSHS                                                       631 - 649
//

Text Mined References (16)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
22405201 2012 FLRT proteins are endogenous latrophilin ligands and regulate excitatory synapse development.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
18593871 2008 Lack of C20orf133 and FLRT3 mutations in 43 patients with Kabuki syndrome in Japan.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706654 2004 FLRT3, a cell surface molecule containing LRR repeats and a FNIII domain, promotes neurite outgrowth.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10644439 1999 Identification of FLRT1, FLRT2, and FLRT3: a novel family of transmembrane leucine-rich repeat proteins.