Property Summary

NCBI Gene PubMed Count 15
PubMed Score 20.63
PubTator Score 8.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count Z-score Confidence
Pulmonary Valve Insufficiency 9 3.669 1.8
Disease Target Count
Kallmann syndrome 33

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.500 3.2e-03
astrocytic glioma -2.000 7.7e-03
Breast cancer -1.100 3.3e-02
cystic fibrosis 1.400 1.1e-03
glioblastoma -1.900 7.5e-03
interstitial cystitis -1.500 8.5e-03
intraductal papillary-mucinous adenoma (... 1.800 3.0e-02
lung adenocarcinoma -1.300 3.3e-05
lung cancer -3.900 3.2e-05
lung carcinoma -3.000 2.9e-23
malignant mesothelioma -6.500 4.9e-10
medulloblastoma, large-cell -2.600 4.5e-04
non-small cell lung cancer -2.721 7.8e-20
oligodendroglioma -1.500 1.8e-02
osteosarcoma 2.632 7.0e-03
ovarian cancer -3.800 1.5e-11
pituitary cancer 1.800 5.9e-03
posterior fossa group A ependymoma -1.200 3.9e-03
ulcerative colitis 1.500 8.1e-03

Gene RIF (4)

AA Sequence

MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQI      1 - 70
NNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSV     71 - 140
SAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNL    141 - 210
LNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSN    211 - 280
NNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNA    281 - 350
ELFDCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS    351 - 420
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMVPMETSNLYLF    421 - 490
DETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVTIALLALVCWYVHRNGSLFS    491 - 560
RNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSES    561 - 630
SSNRSYRDSGIPDSDHSHS                                                       631 - 649
//

Text Mined References (17)

PMID Year Title