Property Summary

NCBI Gene PubMed Count 64
PubMed Score 250.87
PubTator Score 111.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.300 2.5e-02
atypical teratoid / rhabdoid tumor 1.400 1.2e-04
tuberculosis -1.700 2.5e-08
non-small cell lung cancer 1.359 2.8e-20
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-03
pancreatic cancer 1.100 1.0e-04
sonic hedgehog group medulloblastoma 1.100 4.7e-03
lung carcinoma 1.100 1.9e-14
ovarian cancer -1.300 6.3e-05

Protein-protein Interaction (1)

Gene RIF (35)

PMID Text
26491051 F-actin clustering through the interaction with the mutant FLNB actin-binding domain may limit the cytoskeletal reorganization, preventing normal skeletal development.
25925610 FLNb enhances invasion of cancer cells through phosphorylation of MRLC and FAK.
25631074 Cellular biotinylated filamin B, beta (FLNB) protein is incorporated into HIV-1 Gag virus-like particles
25496916 Cellular biotinylated filamin B, beta (FLNB) protein is incorporated into HIV-1 Gag virus-like particles
24176111 Polymorphism at rs11720285, rs11130605 and rs9809315, all of which are located either 5' of the transcription start site or in intron 1 of the FLNB gene has been identified as significantly associated with BMD in Caucasian women.
23401860 VEGF and PKC promote degradation-independent protein ubiquitination of FLNB to control intracellular trafficking of HDAC7.
23401428 study presents two patients with Atelosteogenesis Type I caused by two novel Filamin B (FLNB) mutations affecting the same FLNB residue: c.542G > A, predicting p.Gly181Asp and c.542G > C, predicting p.Gly181Arg
23036857 The structure reveals a new hinge in the linker region between actin binding domain (ABD) and the first filamin repeat that is ideally positioned to orient the ABD for actin binding.
22802962 study indicates that filamins are important regulators of polycystin-2 channel function, and further links actin cytoskeletal dynamics to the regulation of this channel protein
22721673 Cellular biotinylated filamin B, beta (FLNB) protein is incorporated into HIV-1 Gag virus-like particles
22190451 skeletal dysplasias -associated mutations in the actin-binding domain of filamin B cause cytoplasmic focal accumulations correlating with disease severity.
22174152 these data demonstrate that coordinated expression of GPIbalpha and filamin is required for efficient trafficking of either protein to the cell surface, and for production of normal-sized platelets.
20634891 Maternal genes FLNB, HIC1 and ZNF189 were strongly associated with risk of clefting.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19727905 Multiple single nucleotide polymorphisms and haplotypes in FLNB were significantly associated with bone mineral density, with the strongest association between lumbar spine BMD and rs9828717 (p = 0.005).
19727905 Observational study of gene-disease association. (HuGE Navigator)
19505475 High-resolution X-ray crystal structures of the human filamin B wild type actin-binding domain, plus W148R and M202V mutants.
19453265 findings suggest common variants in FLNB have effects on bone structure in women. Although the location of variants having effects is not entirely consistent, variation at 5' end of the gene may reflect effects on levels of FLNB transcription efficiency
19366992 Cellular biotinylated filamin B, beta (FLNB) protein is incorporated into HIV-1 Gag virus-like particles
19054571 Observational study of gene-disease association. (HuGE Navigator)
19052145 anti-inflammatory activity of Serp-1 is mediated through modification of uPAR-linked beta-integrin and filamin B in monocytes, identifying this interaction as a central regulatory axis for inflammation
19039035 FLNB and SBF2 are associated with human stature.
18815275 These results establish a novel function of filamin B as a molecular scaffold in the JNK signaling pathway for type I IFN-induced apoptosis.
18809679 identifies filamin B as a molecular linker that mediates ICAM-1-driven transendothelial migration
18799729 ASB2 may regulate hematopoietic cell differentiation by modulating cell spreading and actin remodeling through targeting of filamins A and B for degradation.
18257094 Spondylocarpotarsal synostosis syndrome in a patient with a causal FLNB mutation.
16801345 Mutations within the FLNB gene is non-random, with clusters of mutations leading to substitutions in the actin-binding domain and filamin repeats 13-17 being the most common cause of Larsen syndrome.
16752402 Novel missense mutations within exon 2 and exon 3 of the FLNB gene are associated with atelosteogenesis I and III.
15994868 We report the identification of mutations in FLNB in two unrelated individuals with boomerang dysplasia. The resultant substitutions, L171R and S235P, lie within the calponin homology 2 region of the actin binding domain and occur at conserved sites.
15054484 mutations cause four distinct disorders of skeletal development
14991055 role in vertebral segmentation, joint formation and endochondral ossification
12119179 Cellular biotinylated filamin B, beta (FLNB) protein is incorporated into HIV-1 Gag virus-like particles
12077712 Observational study of gene-disease association. (HuGE Navigator)
11807098 Different splice variants of filamin-B affect myogenesis, subcellular distribution, and determine binding to integrin [beta] subunits

AA Sequence

MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRP      1 - 70
TFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQT     71 - 140
PKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLG    141 - 210
VPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVD    211 - 280
TISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKA    281 - 350
QGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP    351 - 420
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVT    421 - 490
MKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLH    491 - 560
GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS    561 - 630
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRM    631 - 700
DGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCT    701 - 770
EAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD    771 - 840
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKY    841 - 910
TPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVT    911 - 980
ILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGL    981 - 1050
EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPG   1051 - 1120
SPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTY   1121 - 1190
AVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ   1191 - 1260
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSR   1261 - 1330
VQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNIT   1331 - 1400
YGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVN   1401 - 1470
VVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDF   1471 - 1540
AIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ   1541 - 1610
TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK   1611 - 1680
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLV   1681 - 1750
IPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPN   1751 - 1820
SGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSI   1821 - 1890
LVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNN   1891 - 1960
HIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDA   1961 - 2030
GYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT   2031 - 2100
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVK   2101 - 2170
YRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITF   2171 - 2240
DDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAI   2241 - 2310
RLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQ   2311 - 2380
AGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNY   2381 - 2450
LISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA   2451 - 2520
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEE   2521 - 2590
HIPGSPFHVTVP                                                             2591 - 2602
//

Text Mined References (79)

PMID Year Title
26491051 2016 F-actin clustering and cell dysmotility induced by the pathological W148R missense mutation of filamin B at the actin-binding domain.
25925610 2015 Filamin B Enhances the Invasiveness of Cancer Cells into 3D Collagen Matrices.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24176111 2013 Conditional testing of multiple variants associated with bone mineral density in the FLNB gene region suggests that they represent a single association signal.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23568457 2013 Genetic variants associated with disordered eating.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23401860 2013 Monoubiquitination of filamin B regulates vascular endothelial growth factor-mediated trafficking of histone deacetylase 7.
23401428 2013 Clinical report: Two patients with atelosteogenesis type I caused by missense mutations affecting the same FLNB residue.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23036857 2012 Crystal structure of the filamin N-terminal region reveals a hinge between the actin binding and first repeat domains.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22802962 2012 Structural interaction and functional regulation of polycystin-2 by filamin.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22190451 2012 Disease-associated mutations in the actin-binding domain of filamin B cause cytoplasmic focal accumulations correlating with disease severity.
22174152 2012 GPIb? regulates platelet size by controlling the subcellular localization of filamin.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19727905 2010 Common variants in FLNB/CRTAP, not ARHGEF3 at 3p, are associated with osteoporosis in southern Chinese women.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19505475 2009 Disease-associated substitutions in the filamin B actin binding domain confer enhanced actin binding affinity in the absence of major structural disturbance: Insights from the crystal structures of filamin B actin binding domains.
19453265 2009 Common sequence variation in FLNB regulates bone structure in women in the general population and FLNB mRNA expression in osteoblasts in vitro.
19300455 2009 The E3 ubiquitin ligase specificity subunit ASB2beta is a novel regulator of muscle differentiation that targets filamin B to proteasomal degradation.
19270716 2009 ISG15 modification of filamin B negatively regulates the type I interferon-induced JNK signalling pathway.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
19052145 2009 Myxoma viral serpin, Serp-1, inhibits human monocyte adhesion through regulation of actin-binding protein filamin B.
19039035 2009 Genome-wide association study identifies two novel loci containing FLNB and SBF2 genes underlying stature variation.
18815275 2008 Filamin B serves as a molecular scaffold for type I interferon-induced c-Jun NH2-terminal kinase signaling pathway.
18809679 2008 Filamin B mediates ICAM-1-driven leukocyte transendothelial migration.
18799729 2008 ASB2 targets filamins A and B to proteasomal degradation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18487259 2008 Fine expression profiling of full-length transcripts using a size-unbiased cDNA library prepared with the vector-capping method.
18257094 2008 Expanded clinical spectrum of spondylocarpotarsal synostosis syndrome and possible manifestation in a heterozygous father.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16801345 2007 A molecular and clinical study of Larsen syndrome caused by mutations in FLNB.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16752402 2006 Mutations in two regions of FLNB result in atelosteogenesis I and III.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16106752 2005 Vector-capping: a simple method for preparing a high-quality full-length cDNA library.
16076904 2005 The Z-disc proteins myotilin and FATZ-1 interact with each other and are connected to the sarcolemma via muscle-specific filamins.
15994868 2005 Mutations in FLNB cause boomerang dysplasia.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15054484 2004 Phenotype matters.
14991055 2004 Mutations in the gene encoding filamin B disrupt vertebral segmentation, joint formation and skeletogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12525170 2003 The limits of promiscuity: isoform-specific dimerization of filamins.
12496242 2003 A new member of the LIM protein family binds to filamin B and localizes at stress fibers.
12393796 2002 Filamin A and Filamin B are co-expressed within neurons during periods of neuronal migration and can physically interact.
12077712 2002 TAP, HLA-DQB1, and HLA-DRB1 polymorphism in Colombian patients with primary Sjögren's syndrome.
12006559 2002 Nephrocystin-conserved domains involved in targeting to epithelial cell-cell junctions, interaction with filamins, and establishing cell polarity.
11807098 2002 Different splice variants of filamin-B affect myogenesis, subcellular distribution, and determine binding to integrin [beta] subunits.
11739414 2001 The SH2-containing inositol polyphosphate 5-phosphatase, SHIP-2, binds filamin and regulates submembraneous actin.
11336782 2001 Structural and functional aspects of filamins.
11252955 2001 Filamins as integrators of cell mechanics and signalling.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11153914 2000 Genomic structure and fine mapping of the two human filamin gene paralogues FLNB and FLNC and comparative analysis of the filamin gene family.
10754391 Hepatitis B virus core protein interacts with the C-terminal region of actin-binding protein.
10676904 2000 Effect of medium change on the development of in vitro matured and fertilized bovine oocytes cultured in medium containing amino acids.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
10449914 1999 Assignment of human filamin gene FLNB to human chromosome band 3p14.3 and identification of YACs containing the complete FLNB transcribed region.
9694715 1998 A novel human actin-binding protein homologue that binds to platelet glycoprotein Ibalpha.
9651345 1998 Human beta-filamin is a new protein that interacts with the cytoplasmic tail of glycoprotein Ibalpha.
9437013 1998 Interaction of presenilins with the filamin family of actin-binding proteins.
8327473 1993 Cloning from the thyroid of a protein related to actin binding protein that is recognized by Graves disease immunoglobulins.
7485161 1995 Localization of a gene for autosomal dominant Larsen syndrome to chromosome region 3p21.1-14.1 in the proximity of, but distinct from, the COL7A1 locus.