Property Summary

Ligand Count 347
NCBI Gene PubMed Count 105
PubMed Score 382.79
PubTator Score 173.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 1.7e-02
cystic fibrosis 1.100 1.0e-03
glioblastoma 1.100 3.8e-03
group 3 medulloblastoma -1.100 3.1e-02
malignant mesothelioma -1.300 4.5e-06
osteosarcoma -1.247 5.0e-03
pediatric high grade glioma 1.100 4.0e-03
Pick disease -1.100 1.2e-04
psoriasis 1.100 7.0e-03
tuberculosis 1.400 7.8e-06

Protein-protein Interaction (1)

PDB (49)

Gene RIF (42)

AA Sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG      1 - 70
QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE                                     71 - 108
//

Text Mined References (107)

PMID Year Title