Property Summary

NCBI Gene PubMed Count 52
PubMed Score 380.97
PubTator Score 252.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Liver carcinoma 217
Mammary Neoplasms 410
Disease Target Count P-value
lung cancer 4473 4.6e-08
osteosarcoma 7933 2.9e-07
psoriasis 6685 1.0e-04
diabetes mellitus 1663 4.6e-03
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.074 2.0
Disease Target Count Z-score Confidence
Polydactyly 93 4.481 2.2
Synostosis 18 3.577 1.8

Gene RIF (25)

PMID Text
26828265 Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer.
25329002 Fibroblasts induce expression of FGF4 in ovarian cancer stem-like cells/cancer-initiating cells and upregulate their tumor initiation capacity.
24120895 A de novo 290 kb interstitial duplication of chromosome 11q13.3 including the FGF3 and FGF4 genes.
23939864 Data show that the interaction between Artd1 and Sox2 is crucial for the first steps of the reprogramming process and that early expression of Fgf4 is an essential component for the successful generation of iPSCs.
22237711 In vivo stimulation of BT-474 cell growth by progesterone is associated with up-regulation of FGF4 which may promote tumor growth and maintenance.
21673370 Myoblasts which overexpress FGF-4 exhibit significant changes in cell cycle and pro-angiogenic potential with only slight differences in the expression of the myogenic genes.
21567388 knockdown of FGFR4 expression led to decreased proliferation and an increased rate of apoptosis in the MKN45 and SGC7901 GC cell lines
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
19277121 The combined action of retinoic acid and FGF4 results in induction of PDX1+ foregut endoderm.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18811955 Implantation of human FGF4-soaked beads is sufficient to restore expression of G1- and S-phase cell-cycle genes and S-phase progression in zebrafish sonic hedgehog (Shh) mutant fin buds.
18510611 Observational study of gene-disease association. (HuGE Navigator)
18192227 These results suggest a growth-promoting role for FGF4 in human embryonic stem cells and a putative feedback inhibition mechanism by a novel FGF4 splice isoform that may serve to promote differentiation at later stages of development.
17852409 FGF-4 increases the rate at which MSC proliferate and has no significant effect on MSC pluripotency
17390055 Both myeov and hst (fgf4) are normally situated approximately 475-kb apart at band 11q13, a region that is frequently amplified and overexpressed in various tumours.
14980503 HST-1 protects male germ cells from apoptosis under heat-stress condition in a mouse model.
12841847 FGF4 is upregulated by the OCT3 transcription factor in breast cancer cells.
12172783 results show that Hensen's node and FGFs induce ectopic expression of cardiac lineage markers, and that FGF and TGFbeta family members can modulate early development of the heart
12163055 Differential effects of FGF4, EGF and TGFB1 on functional development of stromal layers (progenitor cell-outputs) in acute myeloid leukemia
12008951 possible role of fibroblast growth factors in expression of genes of the plasminogen activator system in breast fibroblasts
11840335 activation of human HST-1 gene in transgenic mice induces spermatogenesis and prevents adriamycin-induced testicular toxicity

AA Sequence

MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQ      1 - 70
SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMS     71 - 140
SKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL        141 - 206
//

Text Mined References (53)

PMID Year Title
26828265 2016 The oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells.
25329002 2014 Fibroblasts induce expression of FGF4 in ovarian cancer stem-like cells/cancer-initiating cells and upregulate their tumor initiation capacity.
24120895 2014 Increased FGF3 and FGF4 gene dosage is a risk factor for craniosynostosis.
23939864 2013 Artd1/Parp1 regulates reprogramming by transcriptional regulation of Fgf4 via Sox2 ADP-ribosylation.
22237711 2012 Differential expression of FGF family members in a progestin-dependent BT-474 human breast cancer xenograft model.
21673370 2011 Transient and stable transfections of mouse myoblasts with genes coding for pro-angiogenic factors.
21567388 2011 Fibroblast growth factor receptor 4 regulates proliferation and antiapoptosis during gastric cancer progression.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20864512 2010 A panel of sputum-based genomic marker for early detection of lung cancer.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
19277121 2009 FGF4 and retinoic acid direct differentiation of hESCs into PDX1-expressing foregut endoderm in a time- and concentration-dependent manner.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18811955 2008 Distinct roles of Shh and Fgf signaling in regulating cell proliferation during zebrafish pectoral fin development.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18192227 2008 Fibroblast growth factor 4 and its novel splice isoform have opposing effects on the maintenance of human embryonic stem cell self-renewal.
17852409 2007 FGF-4 increases in vitro expansion rate of human adult bone marrow-derived mesenchymal stem cells.
17390055 2007 Rearrangement and expression of myeov and hst in NIH/3T3 transfectants: a caveat for the interpretation of DNA transfection analyses.
17167778 2007 Fibroblast growth factors 2, 4, and 8 exert both negative and positive effects on limb, frontonasal, and mandibular chondrogenesis via MEK-ERK activation.
17133345 2007 Differential signal transduction of alternatively spliced FGFR2 variants expressed in human mammary epithelial cells.
16756958 2006 Fibroblast growth factor 16 and 18 are expressed in human cardiovascular tissues and induce on endothelial cells migration but not proliferation.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
15695515 2005 Interactions of multiple heparin binding growth factors with neuropilin-1 and potentiation of the activity of fibroblast growth factor-2.
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14980503 2004 HST-1/FGF-4 protects male germ cells from apoptosis under heat-stress condition.
12923055 2003 Crystal structure of a POU/HMG/DNA ternary complex suggests differential assembly of Oct4 and Sox2 on two enhancers.
12841847 2003 The POU homeodomain protein OCT3 as a potential transcriptional activator for fibroblast growth factor-4 (FGF-4) in human breast cancer cells.
12660731 2003 The role of PI3K in immune cells.
12172783 2002 Induction of cardiogenesis by Hensen's node and fibroblast growth factors.
12163055 2002 Differential effects of fibroblast growth factor-4, epidermal growth factor and transforming growth factor-beta1 on functional development of stromal layers in acute myeloid leukemia.
12008951 2002 Differential effects of fibroblast growth factors on expression of genes of the plasminogen activator and insulin-like growth factor systems by human breast fibroblasts.
11840335 2002 HST-1/FGF-4 gene activation induces spermatogenesis and prevents adriamycin-induced testicular toxicity.
11743396 2001 From genotype to phenotype: the differential expression of FGF, FGFR, and TGFbeta genes characterizes human cranioskeletal development and reflects clinical presentation in FGFR syndromes.
11486033 2001 Identification of receptor and heparin binding sites in fibroblast growth factor 4 by structure-based mutagenesis.
11294897 2001 Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.
11023873 2000 BMP4 rescues a non-cell-autonomous function of Msx1 in tooth development.
11021964 2000 Fibroblast growth factors, their receptors and signaling.
10579907 1999 Phospholipase C-gamma as a signal-transducing element.
10089404 1999 High-resolution structures of three new trypsin-squash-inhibitor complexes: a detailed comparison with other trypsins and their complexes.
9139660 1997 Structures of the tyrosine kinase domain of fibroblast growth factor receptor in complex with inhibitors.
8663044 1996 Receptor specificity of the fibroblast growth factor family.
3283658 1988 Chromosomal localization of the hst oncogene and its co-amplification with the int.2 oncogene in a human melanoma.
3060803 1988 The FGF-related oncogene, K-FGF, maps to human chromosome region 11q13, possibly near int-2.
2974287 1988 Two homologous oncogenes, HST1 and INT2, are closely located in human genome.
2959959 1987 Genomic sequence of hst, a transforming gene encoding a protein homologous to fibroblast growth factors and the int-2-encoded protein.
2957062 1987 An oncogene isolated by transfection of Kaposi's sarcoma DNA encodes a growth factor that is a member of the FGF family.
2953031 1987 cDNA sequence of human transforming gene hst and identification of the coding sequence required for transforming activity.
1697263 1990 Cloning and expression of two distinct high-affinity receptors cross-reacting with acidic and basic fibroblast growth factors.
1611909 1992 Localization of the 5' end of the MCF2 oncogene to human chromosome 15q15----q23.