Property Summary

NCBI Gene PubMed Count 35
PubMed Score 53.05
PubTator Score 46.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 4.700 6.9e-07

Synonym

Accession Q9NP95 B2RPH5 FGF-20
Symbols RHDA2
FGF-20

Gene

PANTHER Protein Class (2)

PDB

3F1R  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (27)

PMID Text
26070653 The results of this study indicated that rs12720208 may contribute to the risk of PD in Iranian population.
25030126 Meta-analysis suggests that FGF20 rs1721100 C/G polymorphism is associated with sporadic sporadic Parkinson's diseases in Asians
24942208 The meta-analysis showed an association between FGF20 gene rs1721100 polymorphism and risk of Parkinson's disease under a recessive model.
23938014 The results showed no significant differences in the presence of rs1721100 or rs12720208 in the FGF20 gene between Parkinson's disease patients and controls.
23516905 The results have not shown any effect of rs12720208 in the FGF20 gene on the risk of Parkinson's disease in patients residing in Russia
22698282 The data suggested that Fgf9/20 and Bmp7 organize the nephron progenitor niche and highlight the essential role of FGF20 in human kidney development. FGF signaling likely regulates multiple important steps in the stem cell niche.
22342445 This study revealed that the rs1721100(C/G) polymorphism is a risk factor for PD in Han Chinese population, while rs12720208(C/T) polymorphism is not significantly associated with Parkinson's disease.
20471450 The common FGF20 rs12720208 SNP was not associated with the risk for Parkinson's disease (PD) in our population. In addition, we did not find nucleotide changes in miR-433 (that binds to the 3' UTR FGF20 mRNA) among our PD patients.
20471450 Observational study of gene-disease association. (HuGE Navigator)
20427658 The associations described, from mRNA expression to brain morphology to cognition and an interaction with aging, confirm a role of FGF20 in human brain structure and function during development and aging.
20427658 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19619121 The effect of arginine on the solubility and stability of FGF-20 was dominated by the preferential binding interaction.
19564416 Data demonstrate that homodimerization autoregulates FGF9 and FGF20's receptor binding and concentration gradients in the extracellular matrix.
19133659 Observational study of gene-disease association. (HuGE Navigator)
18568448 FGF20 is associated with Parkinson's disease synergistically with SNCA.
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18252210 Variation in the miRNA-433 binding site of FGF20 confers risk for Parkinson disease by overexpression of alpha-synuclein.
18252210 Observational study of gene-disease association. (HuGE Navigator)
18205889 Variants in FGF20 and MAOB show evidence of statistical interactions and potential patterns of biological interaction contributing to Parkinson disease risk.
18205889 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17515805 Observational study of gene-disease association. (HuGE Navigator)
17515805 results suggest that the FGF20 gene is a susceptibility gene for Parkinson's disease in the Japanese population
15967032 Observational study of gene-disease association. (HuGE Navigator)
15592430 Data show that FGF20 and DKK1 appear to be direct targets for beta-catenin/TCF transcriptional regulation via LEF/TCF-binding sites, and are expressed early in Xenopus embryogenesis under the control of the Wnt signaling pathway
15122513 Fibroblast growth factor 20 polymorphisms and haplotypes is associated with the risk of Parkinson disease
10913340 FGF20, FGF9, and FGF16 constitute a subfamily among FGFs. FGF20 is preferentially expressed in colorectal cancer.

AA Sequence

MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLY      1 - 70
CRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFR     71 - 140
EQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMY    141 - 210
T//

Text Mined References (37)

PMID Year Title
26070653 2015 Variation in the miRNA-433 binding site of FGF20 is a risk factor for Parkinson's disease in Iranian population.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
25030126 2015 Quantitative assessment of the association between fibroblast growth factor 20 rs1721100 C/G polymorphism and the risk of sporadic Parkinson's diseases: a meta-analysis.
24942208 2014 Fibroblast growth factor 20 (FGF20) gene polymorphism and risk of Parkinson's disease: a meta-analysis.
24157794 2013 Dynamic modulation of FGFR1-5-HT1A heteroreceptor complexes. Agonist treatment enhances participation of FGFR1 and 5-HT1A homodimers and recruitment of ?-arrestin2.
23938014 2013 Fibroblast growth factor 20 polymorphism in sporadic Parkinson's disease in Northern Han Chinese.
23516905 2012 [Analysis of the rs12720208 single-nucleotide polymorphism of the FGF20 gene in Russian patients with sporadic Parkinson's disease].
22698282 2012 FGF9 and FGF20 maintain the stemness of nephron progenitors in mice and man.
22342445 2012 Fibroblast growth factor 20 (FGF20) polymorphism is a risk factor for Parkinson's disease in Chinese population.
20471450 2010 FGF20 rs12720208 SNP and microRNA-433 variation: no association with Parkinson's disease in Spanish patients.
20427658 2010 Genetic variation in FGF20 modulates hippocampal biology.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
19619121 2009 Effects of pH and arginine on the solubility and stability of a therapeutic protein (Fibroblast Growth Factor 20): relationship between solubility and stability.
19564416 2009 Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix.
19133659 2009 FGF20 and Parkinson's disease: no evidence of association or pathogenicity via alpha-synuclein expression.
18982104 2008 Growth factors and feeder cells promote differentiation of human embryonic stem cells into dopaminergic neurons: a novel role for fibroblast growth factor-20.
18568448 2008 Calbindin 1, fibroblast growth factor 20, and alpha-synuclein in sporadic Parkinson's disease.
18252210 2008 Variation in the miRNA-433 binding site of FGF20 confers risk for Parkinson disease by overexpression of alpha-synuclein.
18205889 2008 Gene-gene interaction between FGF20 and MAOB in Parkinson disease.
17515805 2007 Fibroblast growth factor 20 gene and Parkinson's disease in the Japanese population.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16988046 2006 A specific survival response in dopamine neurons at most risk in Parkinson's disease.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
15967032 2005 Lack of evidence for a genetic association between FGF20 and Parkinson's disease in Finnish and Greek patients.
15592430 2005 FGF-20 and DKK1 are transcriptional targets of beta-catenin and FGF-20 is implicated in cancer and development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
15122513 2004 Fibroblast growth factor 20 polymorphisms and haplotypes strongly influence risk of Parkinson disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306498 2001 Identification of a novel human fibroblast growth factor and characterization of its role in oncogenesis.
11276432 2001 Fibroblast growth factors.
11032730 2000 FGF-20, a novel neurotrophic factor, preferentially expressed in the substantia nigra pars compacta of rat brain.
10913340 2000 Molecular cloning and characterization of human FGF-20 on chromosome 8p21.3-p22.
10629055 2000 FRS2 proteins recruit intracellular signaling pathways by binding to diverse targets on fibroblast growth factor and nerve growth factor receptors.
10579907 1999 Phospholipase C-gamma as a signal-transducing element.