Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma 1.400 1.8e-03
interstitial lung disease 1.300 3.0e-02
astrocytic glioma 1.200 1.0e-02
cutaneous lupus erythematosus 1.200 9.6e-03
osteosarcoma -3.706 1.4e-08
tuberculosis 2.900 2.1e-09
non-small cell lung cancer -1.277 4.7e-18
interstitial cystitis 1.600 2.7e-02
primary Sjogren syndrome 1.700 6.6e-03
subependymal giant cell astrocytoma 1.446 1.7e-02
psoriasis 1.200 1.4e-09
lung carcinoma -1.300 5.7e-18
mucosa-associated lymphoid tissue lympho... 1.369 4.5e-02
ulcerative colitis 1.100 7.8e-04
ovarian cancer 1.100 7.4e-10

Gene RIF (1)

PMID Text
18838382 FGD2 has a role in leukocyte signaling and vesicle trafficking in cells specialized to present antigen in the immune system

AA Sequence

MKGASEEKLASVSNLVTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSR      1 - 70
RYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSK     71 - 140
AFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYVKNFERAAELL    141 - 210
ATWTDKSPLFQEVLTRIQSSEASGSLTLQHHMLEPVQRIPRYELLLKEYIQKLPAQAPDQADAQKALDMI    211 - 280
FSAAQHSNAAITEMERLQDLWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLY    281 - 350
CVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQI    351 - 420
EKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCA    421 - 490
RCSDYRAELKYDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGK    491 - 560
SGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKG    561 - 630
RWVKAMERAASGWSPSWPNDGDLSD                                                 631 - 655
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18838382 2008 FGD2, a CDC42-specific exchange factor expressed by antigen-presenting cells, localizes to early endosomes and active membrane ruffles.
17564959 2007 Mutations in FGD4 encoding the Rho GDP/GTP exchange factor FRABIN cause autosomal recessive Charcot-Marie-Tooth type 4H.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
10458911 1999 Isolation, characterization, and mapping of the mouse and human Fgd2 genes, faciogenital dysplasia (FGD1; Aarskog syndrome) gene homologues.