Property Summary

Ligand Count 1
NCBI Gene PubMed Count 25
PubMed Score 54.95
PubTator Score 34.61

Knowledge Summary

Patent (4,253)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Obesity 678 3.898 1.9
diabetes mellitus 1728 3.237 1.6

Expression

Gene RIF (16)

AA Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPF      1 - 70
RMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACW     71 - 140
LLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWI    141 - 210
LGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSS    211 - 280
SGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES        281 - 346
//

Text Mined References (27)

PMID Year Title