Property Summary

NCBI Gene PubMed Count 23
PubMed Score 48.76
PubTator Score 34.61

Knowledge Summary

Patent (4,253)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Obesity 616 3.883 1.9
diabetes mellitus 1663 3.24 1.6

Expression

Gene RIF (14)

PMID Text
26260360 Our data suggest that GPR42 be reclassified as a functioning gene and that recognition of sequence and copy number polymorphism of the FFAR3/GPR42 complex be considered during genetic and pharmacological investigation of these receptors.
25581519 FFAR3 is expressed in pancreatic beta cells and mediates an inhibition of insulin secretion by coupling to Gi-type G proteins.
24325907 a significant correlation between a higher body mass index and lower methylation in the promoter region of FFAR3 in type 2 diabetes and obesity patients
23066016 Extracellular ionic locks determine variation in constitutive activity and ligand potency between species orthologs of the free fatty acid receptors FFA2 and FFA3
22884094 GPR41 activation inhibits histone acetylation and cell growth.
22712802 Propionate-stimulated GPR41 strongly coupled to ERK1/2 activation, while the coupling of linoleic acid-activated GPR40 and acetate-activated GPR43 was weaker.
22493486 GPR41 gene expression is mediated by internal ribosome entry site (IRES)-dependent translation of bicistronic mRNA encoding GPR40 and GPR41 proteins
21220428 Selective orthosteric free fatty acid receptor 2 (FFA2) agonists: identification of the structural and chemical requirements for selective activation of FFA2 versus FFA3.
19630535 Study presents evidence showing that the six amino acid differences, including that R/W174 are polymorphisms rather than gene-specific differences between GPR41 and GPR42.
19574715 Results suggest that GPR41 expressed in human colonic mucosa may function as a sensor for luminal short-chain fatty acids.
18801738 analysis of conserved polar residues in transmembrane domains V, VI, and VII of free fatty acid receptor 2 and free fatty acid receptor 3 are required for the binding and function of short chain fatty acids
16887331 GPR41 and 43 mediate SCFA signaling in mammary epithelial cells and thereby play an important role in their stress management.
14722361 C2-C6 short-chain fatty acids, ligands of an orphan G protein-coupled receptor GPR41, stimulate leptin expression in both a mouse adipocyte cell line and mouse adipose tissue in primary culture
12711604 characterization of GP41 in human tissue as a receptor for short chain fatty acids

AA Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPF      1 - 70
RMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACW     71 - 140
LLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWI    141 - 210
LGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSS    211 - 280
SGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES        281 - 346
//

Text Mined References (25)

PMID Year Title
26260360 2015 Human GPR42 is a transcribed multisite variant that exhibits copy number polymorphism and is functional when heterologously expressed.
25581519 2015 Loss of FFA2 and FFA3 increases insulin secretion and improves glucose tolerance in type 2 diabetes.
24325907 2014 Effects of short chain fatty acid producing bacteria on epigenetic regulation of FFAR3 in type 2 diabetes and obesity.
23066016 2012 Extracellular ionic locks determine variation in constitutive activity and ligand potency between species orthologs of the free fatty acid receptors FFA2 and FFA3.
22884094 2012 Butyrate-induced GPR41 activation inhibits histone acetylation and cell growth.
22712802 2012 Receptor-specific regulation of ERK1/2 activation by members of the "free fatty acid receptor" family.
22493486 2012 GPR41 gene expression is mediated by internal ribosome entry site (IRES)-dependent translation of bicistronic mRNA encoding GPR40 and GPR41 proteins.
21518883 2011 Short-chain fatty acids and ketones directly regulate sympathetic nervous system via G protein-coupled receptor 41 (GPR41).
21220428 2011 Selective orthosteric free fatty acid receptor 2 (FFA2) agonists: identification of the structural and chemical requirements for selective activation of FFA2 versus FFA3.
19630535 2009 Sequence polymorphisms provide a common consensus sequence for GPR41 and GPR42.
19574715 2009 Expression of short-chain fatty acid receptor GPR41 in the human colon.
19460454 2009 Free fatty acid receptors act as nutrient sensors to regulate energy homeostasis.
18801738 2008 Conserved polar residues in transmembrane domains V, VI, and VII of free fatty acid receptor 2 and free fatty acid receptor 3 are required for the binding and function of short chain fatty acids.
16887331 2007 Short-chain fatty acids induce acute phosphorylation of the p38 mitogen-activated protein kinase/heat shock protein 27 pathway via GPR43 in the MCF-7 human breast cancer cell line.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15684720 2005 A family of fatty acid binding receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14722361 2004 Short-chain fatty acids stimulate leptin production in adipocytes through the G protein-coupled receptor GPR41.
12711604 2003 Functional characterization of human receptors for short chain fatty acids and their role in polymorphonuclear cell activation.
12496283 2003 The Orphan G protein-coupled receptors GPR41 and GPR43 are activated by propionate and other short chain carboxylic acids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9344866 1997 A cluster of four novel human G protein-coupled receptor genes occurring in close proximity to CD22 gene on chromosome 19q13.1.
8496602 1993 Genomic structure and chromosomal mapping of the human CD22 gene.
1985119 1991 cDNA cloning of the B cell membrane protein CD22: a mediator of B-B cell interactions.