Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.60
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.7e-04
glioblastoma 1.500 3.1e-02
intraductal papillary-mucinous adenoma (... 1.100 9.3e-03
intraductal papillary-mucinous carcinoma... 1.100 1.4e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.5e-03
invasive ductal carcinoma -1.097 1.5e-02
lung cancer -1.200 3.3e-04
medulloblastoma, large-cell -1.200 2.5e-02
ovarian cancer 1.200 4.0e-04
spina bifida -1.776 4.9e-02
tuberculosis -1.600 1.4e-06

Gene RIF (3)

AA Sequence

MDLKTAVFNAARDGKLRLLTKLLASKSKEEVSSLISEKTNGATPLLMAARYGHLDMVEFLLEQCSASIEV      1 - 70
GGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNSTPLRAACFDGHLEIVKYLVEHKA     71 - 140
DLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRKSVKGNTALHDCAESGSLDIMKMLLMYCAKMEK    141 - 210
DGYGMTPLLSASVTGHTNIVDFLTHHAQTSKTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDR    211 - 280
TNIISKPVPQTLIMAYDYAKEVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYAD    281 - 350
SGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVL    351 - 420
EIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAV    421 - 490
DKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLH    491 - 560
KQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHIPEKLETFVSLHR                 561 - 617
//

Text Mined References (12)

PMID Year Title