Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.01
PubTator Score 9.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.500 8.1e-04
hepatocellular carcinoma 1.800 2.0e-06
pancreatic cancer 1.300 7.1e-03
Multiple myeloma 1.234 1.7e-02
malignant mesothelioma 1.100 1.1e-05
astrocytic glioma -1.100 5.0e-02
atypical teratoid / rhabdoid tumor -1.600 1.4e-05
glioblastoma -1.400 3.1e-05
medulloblastoma, large-cell -1.300 1.3e-03
juvenile dermatomyositis 1.399 8.7e-11
acute quadriplegic myopathy 2.097 6.7e-08
tuberculosis and treatment for 6 months 1.900 1.1e-05
colon cancer -1.700 4.4e-02
adult high grade glioma -1.100 2.8e-03
group 4 medulloblastoma 1.100 3.5e-03
pancreatic carcinoma 1.300 7.1e-03
Breast cancer -1.300 4.0e-15
ovarian cancer 1.200 3.5e-04
dermatomyositis 1.600 2.1e-03

Synonym

Accession Q9UK73 O43146 FEM1b
Symbols F1AA
F1A-ALPHA
FEM1-beta

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
24076122 These findings have implications for understanding the cellular functions of Fem1b, and the regulation of Gli1 oncoprotein activity.
20200332 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19908242 the proapoptotic protein Fem1b is downregulated by the proteasome in malignant colon cancer cells and mediates proteasome inhibitor-induced apoptosis of these cells
19330022 FEM1B is required for Rad9 recruitment and CHK1 activation in response to replication stress.
18757445 This study presents evidence suggesting a role for FEM1A and FEM1B in the pathogenesis of polycystic ovary syndrome. Only FEM1B variants were associated with insulin-related traits in PCOS women.
18757445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYR      1 - 70
VQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYL     71 - 140
VENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWR    141 - 210
AAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAM    211 - 280
LERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYR    281 - 350
GAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQ    351 - 420
SMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL    421 - 490
AVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLV    491 - 560
EAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH       561 - 627
//

Text Mined References (21)

PMID Year Title
24076122 2013 Fem1b promotes ubiquitylation and suppresses transcriptional activity of Gli1.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19908242 2010 Fem1b, a proapoptotic protein, mediates proteasome inhibitor-induced apoptosis of human colon cancer cells.
19330022 2009 Human FEM1B is required for Rad9 recruitment and CHK1 activation in response to replication stress.
18757445 2008 FEM1A and FEM1B: novel candidate genes for polycystic ovary syndrome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17003112 2006 Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH).
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11559703 2001 The Caenorhabditis elegans sex-determining protein FEM-2 and its human homologue, hFEM-2, are Ca2+/calmodulin-dependent protein kinase phosphatases that promote apoptosis.
10764728 2000 The Caenorhabditis elegans sex determination protein FEM-1 is a CED-3 substrate that associates with CED-4 and mediates apoptosis in mammalian cells.
10623617 2000 Sequence, organization, and expression of the human FEM1B gene.
10542291 1999 F1Aalpha, a death receptor-binding protein homologous to the Caenorhabditis elegans sex-determining protein, FEM-1, is a caspase substrate that mediates apoptosis.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.