Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.12
PubTator Score 9.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 2.097 6.7e-08
adult high grade glioma -1.100 2.8e-03
astrocytic glioma -1.100 5.0e-02
atypical teratoid / rhabdoid tumor -1.600 1.4e-05
Breast cancer -1.300 4.0e-15
colon cancer -1.700 4.4e-02
dermatomyositis 1.600 2.1e-03
gastric cancer 1.500 8.1e-04
glioblastoma -1.400 3.1e-05
group 4 medulloblastoma 1.100 3.5e-03
hepatocellular carcinoma 1.800 2.0e-06
juvenile dermatomyositis 1.399 8.7e-11
malignant mesothelioma 1.100 1.1e-05
medulloblastoma, large-cell -1.300 1.3e-03
Multiple myeloma 1.234 1.7e-02
ovarian cancer 1.200 3.5e-04
pancreatic cancer 1.300 7.1e-03
pancreatic carcinoma 1.300 7.1e-03
tuberculosis -1.200 1.0e-02

Gene RIF (8)

AA Sequence

MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYR      1 - 70
VQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYL     71 - 140
VENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWR    141 - 210
AAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAM    211 - 280
LERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYR    281 - 350
GAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQ    351 - 420
SMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL    421 - 490
AVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLV    491 - 560
EAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH       561 - 627
//

Text Mined References (22)

PMID Year Title