Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.00
PubTator Score 12.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -4.852 7.4e-11
tuberculosis and treatment for 3 months 3.000 3.0e-05
interstitial cystitis 2.000 2.8e-02
primary Sjogren syndrome 1.800 3.4e-05
nasopharyngeal carcinoma -1.400 2.1e-03
psoriasis 1.300 5.8e-05

Gene RIF (8)

PMID Text
25738996 FCRL1 gene expression down-regulates in both Hashimoto and Graves disease patients compared to normal subjects.
23950870 Data show the Differences in high resolution melting analysis in promoters of tumor markers neuronal membrane glycoprotein M6-B, melanoma antigen family A12 and immunoglobulin superfamily Fc receptor indicated invasiveness of hepatocellular carcinoma.
22888639 Expression level of FCRL1 gene in peripheral blood B-lymphocytes is significantly higher in patients with autoimmune diseases.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18802695 Down-regulation of FCRL1 is associated with acute lymphoblastic leukemia.
18704934 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
15479727 FcRH1 thus has the potential to serve as an activating coreceptor on B cells.

AA Sequence

MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPK      1 - 70
LQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGT     71 - 140
GDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPIL    141 - 210
MLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANN    211 - 280
GLGAQRSEAVTLNFTVPTGARSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPL    281 - 350
PQEFTYLNSPTPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI    351 - 420
TDVDYEDAM                                                                 421 - 429
//

Text Mined References (21)

PMID Year Title
25738996 2015 Expression Profile of Human Fc Receptor-Like 1, 2, and 4 Molecules in Peripheral Blood Mononuclear Cells of Patients with Hashimoto's Thyroiditis and Graves' Disease.
23950870 2013 Discovery and validation of DNA hypomethylation biomarkers for liver cancer using HRM-specific probes.
22888639 [Expression of human B-cell specific receptor FCRL1 in normal individuals and in patients with autoimmune diseases].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18802695 2009 Low representation of Fc receptor-like 1-5 molecules in leukemic cells from Iranian patients with acute lymphoblastic leukemia.
18704934 2008 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895404 2008 FCRL1 on chronic lymphocytic leukemia, hairy cell leukemia, and B-cell non-Hodgkin lymphoma as a target of immunotoxins.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16849395 2006 Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479727 2005 FcRH1: an activation coreceptor on human B cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12037601 2002 A family of highly diverse human and mouse genes structurally links leukocyte FcR, gp42 and PECAM-1.
11929751 2002 IRTAs: a new family of immunoglobulinlike receptors differentially expressed in B cells.
11493702 2001 Identification of a family of Fc receptor homologs with preferential B cell expression.