Property Summary

NCBI Gene PubMed Count 55
PubMed Score 118.62
PubTator Score 37.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.9e-06
Multiple myeloma 1.020 4.5e-03
osteosarcoma -1.819 1.6e-03
ovarian cancer -1.600 1.1e-07
psoriasis -1.600 1.6e-04

Gene RIF (29)

AA Sequence

MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVS      1 - 70
GDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSML     71 - 140
GPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLES    141 - 210
GYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLL    211 - 280
PESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVR    281 - 350
SVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH    351 - 420
TIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPG    421 - 490
PNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM                                          491 - 522
//

Text Mined References (57)

PMID Year Title