Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.08
PubTator Score 24.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
medulloblastoma, large-cell -1.500 2.1e-03
juvenile dermatomyositis 1.205 2.0e-08
tuberculosis 2.100 5.5e-05
active Crohn's disease 1.446 8.4e-03
ulcerative colitis 2.000 1.2e-08
interstitial cystitis 1.200 1.3e-02
psoriasis 1.200 1.0e-24
breast carcinoma 1.100 1.0e-18
Breast cancer 1.400 5.4e-11
invasive ductal carcinoma 1.100 2.3e-02
ovarian cancer 1.400 2.9e-04

Gene RIF (6)

PMID Text
25374377 It might inhibit cadmium-induced ER stress by functioning as a ubiquitin ligase in the ERAD system, thereby attenuating the cell death induced by subsequent JNK1 activation.
22292078 Two interacting proteins of human FBXO6 protein have been found using the service in the study.
22268729 systematical identification of the FBXO6-interacting glycoproteins, critical for clarifying its substrates as well as biological functions.
22190034 HIV-1 gp41 is identified to have a physical interaction with F-box protein 6 (FBXO6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19716789 Fbx6-dependent Chk1 degradation contributes to S phase checkpoint termination and that a defect in this mechanism might increase tumor cell resistance to certain anticancer drugs.
12939278 Fbs2 is a novel member of F-box protein family that recognizes N-glycans and plays a role in ERAD

AA Sequence

MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQ      1 - 70
PVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMC     71 - 140
LKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNN    141 - 210
ATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEE    211 - 280
AAQSPYRAVVQIF                                                             281 - 293
//

Text Mined References (18)

PMID Year Title
25374377 2014 FBXO6 attenuates cadmium toxicity in HEK293 cells by inhibiting ER stress and JNK activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22292078 2012 SPPS: a sequence-based method for predicting probability of protein-protein interaction partners.
22268729 2012 Proteomic identification of common SCF ubiquitin ligase FBXO6-interacting glycoproteins in three kinds of cells.
21269460 2011 Initial characterization of the human central proteome.
19716789 2009 The F box protein Fbx6 regulates Chk1 stability and cellular sensitivity to replication stress.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18203720 2008 Diversity in tissue expression, substrate binding, and SCF complex formation for a lectin family of ubiquitin ligases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939278 2003 Fbs2 is a new member of the E3 ubiquitin ligase family that recognizes sugar chains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383498 2002 A new subfamily of structurally related human F-box proteins.
10945468 2000 cDNA cloning and expression analysis of new members of the mammalian F-box protein family.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.