Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.07
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma -1.400 3.4e-11
glioblastoma -1.400 3.8e-10
group 3 medulloblastoma -1.400 7.3e-04
atypical teratoid / rhabdoid tumor -1.100 3.2e-05
medulloblastoma, large-cell -1.100 8.7e-05
adult high grade glioma -1.300 1.3e-04

Synonym

Accession Q9H4M3 B3KNZ2 B7Z743 Q5TGX2 Q5TGX4 Q5TGX5 Q68DJ9 Q8WWY2
Symbols FBG3
FBX30
FBX6A
Fbx44
Fbxo6a

Gene

PDB

3WSO  

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

 IMPC Phenotype (1)

Gene RIF (4)

PMID Text
26460611 Although the overall structure of FBG3 is similar to that of Fbs1, the residues that form the Fbs1 carbohydrate-binding pocket failed to be superposed with the corresponding residues of FBG3.
25970626 FBXO44-mediated degradation of RGS2 protein uniquely depends on a Cul4B/DDB1 complex.
23086937 FBXO44 mediates BRCA1 ubiquitination and degradation
20057081 Skp1 and Fbg3 were co-expressed in E. coli. The plate-shaped crystals belonged to space group P2(1)2(1)2(1), with unit-cell parameters a = 34.1, b = 76.6, c = 193.9 A and one molecule per asymmetric unit.

AA Sequence

MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI      1 - 70
FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVD     71 - 140
LKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVS    141 - 210
HTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP                             211 - 255
//

Text Mined References (16)

PMID Year Title
26460611 2015 The Structural Differences between a Glycoprotein Specific F-Box Protein Fbs1 and Its Homologous Protein FBG3.
25970626 2015 FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex.
25416956 2014 A proteome-scale map of the human interactome network.
23086937 2012 The F-box protein FBXO44 mediates BRCA1 ubiquitination and degradation.
20057081 2010 Crystallization and preliminary X-ray characterization of the Skp1-Fbg3 complex.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
18203720 2008 Diversity in tissue expression, substrate binding, and SCF complex formation for a lectin family of ubiquitin ligases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383498 2002 A new subfamily of structurally related human F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.