Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.07
PubTator Score 2.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-03
atypical teratoid / rhabdoid tumor -1.100 3.2e-05
ependymoma -1.200 3.5e-11
glioblastoma -1.400 3.8e-10
group 3 medulloblastoma -1.400 7.3e-04
medulloblastoma, large-cell -1.100 8.7e-05

Synonym

Accession Q9H4M3 B3KNZ2 B7Z743 Q5TGX2 Q5TGX4 Q5TGX5 Q68DJ9 Q8WWY2
Symbols FBG3
FBX30
FBX6A
Fbx44
Fbxo6a

Gene

PDB

3WSO   5B4N  

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI      1 - 70
FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVD     71 - 140
LKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVS    141 - 210
HTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP                             211 - 255
//

Text Mined References (18)

PMID Year Title