Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.41
PubTator Score 2.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 6.4e-03
ependymoma -1.100 6.6e-03
non diabetic and post-ischemic heart fai... 1.500 3.8e-02
Duchenne muscular dystrophy -1.757 1.1e-06
limb girdle muscular dystrophy 2B -1.383 6.0e-04
acute quadriplegic myopathy -2.301 2.7e-07
psoriasis -1.300 1.9e-12

Gene RIF (1)

PMID Text
17928169 FBXO40 may function as a regulator involved in the postnatal myogenesis.

AA Sequence

MGKARRSPPGHHRHCEGCFNRHCHIPVEPNTSCLVISCHLLCGATFHMCKEAEHQLLCPLEQVPCLNSEY      1 - 70
GCPLSMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETTLHENIMKETPSEECLDTALALQDQKVLFRS     71 - 140
LKMVELFPETREATEEEPTMNGETSVEEMGGAVGGVDIGLVPHGLSATNGEMAELSQEEREVLAKTKEGM    141 - 210
DLVKFGQWENIFSKEHAASALTNSSASCESKNKNDSEKEQISSGHNMVEGEGAPKKKEPQENQKQQDVRT    211 - 280
AMETTGLAPWQDGVLERLKTAVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGKLEAQEVKTVYTF    281 - 350
KVPVSYCGKRARLGDAMLSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTLQCALERELKGHVISESRSID    351 - 420
GLFMDFATQTYNFEPEQFSSGTVLADLTAATPGGLHVELHSECVTRRHNKSSSAFTFTCNKFFRRDEFPL    421 - 490
HFKNVHTDIQSCLNGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQELKTFAIKPEVAPELSEGRKNN    491 - 560
HLLGHGGKSQNSLTSLPLEILKYIAGFLDSVSLAQLSQVSVLMRNICATLLQERGMVLLQWKKKRYSHGG    561 - 630
TSWRVHREIWQFSSLFSKIKSWEFNEVTSMSEHLKSCPFNIVEHKTDPILLTSMCQPREQARESLVSTFR    631 - 700
IRPRGRYVS                                                                 701 - 709
//

Text Mined References (11)

PMID Year Title
23223146 2013 A genome-wide association study in Caucasian women points out a putative role of the STXBP5L gene in facial photoaging.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17928169 2007 FBXO40, a gene encoding a novel muscle-specific F-box protein, is upregulated in denervation-related muscle atrophy.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.