Property Summary

NCBI Gene PubMed Count 6
PubMed Score 258.89
PubTator Score 10.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 2.3e-02
psoriasis 2.200 2.7e-05
ependymoma -1.400 2.6e-08
glioblastoma -1.900 5.1e-05
medulloblastoma -1.700 3.5e-05
atypical teratoid / rhabdoid tumor -2.100 3.3e-09
medulloblastoma, large-cell -1.600 6.7e-06
primitive neuroectodermal tumor -1.400 4.3e-05
adult high grade glioma -2.000 2.3e-06
pilocytic astrocytoma -1.200 3.7e-06
ovarian cancer 1.900 3.2e-08

AA Sequence

MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQV      1 - 70
GPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCP     71 - 140
RLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAA    141 - 210
VQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLH    211 - 280
QALVLLQDMAGFAPFVNLQV                                                      281 - 300
//

Text Mined References (7)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21572392 2011 SCFFBXL¹? regulates BMP signalling by directing the degradation of HECT-type ubiquitin ligase Smurf1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.