Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 1.5e-05
atypical teratoid / rhabdoid tumor -1.300 1.8e-04
breast carcinoma 1.600 3.6e-02
glioblastoma -1.400 5.2e-08
group 3 medulloblastoma 1.400 1.4e-04
lung adenocarcinoma 1.900 5.3e-09
medulloblastoma, large-cell 1.100 5.4e-04
Multiple Sclerosis 1.500 3.4e-03
osteosarcoma -2.729 6.3e-06
ovarian cancer -1.100 3.4e-05
posterior fossa group B ependymoma -1.100 6.8e-08
subependymal giant cell astrocytoma -1.904 1.9e-02

Gene RIF (1)

AA Sequence

MEAKVRPSRRSRAQRDRGRRREAARDARAQSPSSGDEPEPSPGKENAGLRGAPPRGAAPAPRTARPPRRR      1 - 70
RRESSSQEEEVIDGFAIASFSTLEALEKDMALKPHERKEKWERRLIKKPRESETCPPAEPSENRRPLEAG     71 - 140
SPGQDLEPACDGARKVPLQPSKQMKVTVSKGGDRDSDDDSVLEATSSRDPLSDSSAHAVSGRGYSCDSES    141 - 210
GPDDKASVGSEKLFAPGTDKGPALEKSEAKAGPVPKVSGLERSRELSAESFLPTASPAPHAAPCPGPPPG    211 - 280
SRANPLVKKEPPAPHRHTPQPPPPQPRGLLPTHVPASLGAFAGHSQAAANGLHGLSRSSSAPLGLGKHVS    281 - 350
LSPHGPGPHLSTSHLALRSQAQHQLHAAMFAAPPTLPPPPALPASSLVLPGHPADHELLRQELNTRFLVQ    351 - 420
SAERPGASLGPGALLRAEFHQHQHTHQHTHQHTHQHQHTFAPFPAGLPPTPPAAPPPFDKYAPKLDSPYF    421 - 490
RHSSVSFFPSFPPAIPGLPTLLPHPGPFGSLQGAFQPKVSDPYRAVVKVSTCWEGPWQGRTLVPPGRPRG    491 - 560
ARDSRSLQKTWVGVAPAPLSASILSQKPGRWCAVHVQIAWQIYRHQQKIKEMQLDPHKLEVGAKLDLFGR    561 - 630
PPAPGVFAGFHYPQDLARPLFPSTGAAHPASNPFGPSAHPGSFLPTGPLTDPFSRPSTFGGLGSLSSHAF    631 - 700
GGLGSHALAPGGSIFAPKEGSSVHGLPSPHEAWNRLHRAPPSFPAPPPWPKSVDAERVSALTNHDREPDN    701 - 770
GKEEQERDLLEKTRLLSRASPATPAGHPVSGLLLRAQSELGRSGAPAEREAEPRVKESRSPAKEEAAKMP    771 - 840
ARASPPHSKAAPGDVKVKEERGEDEASEPPAGGLHPAPLQLGLGRERLGAPGFAWEPFRGLELPRRAFPA    841 - 910
AAPAPGSAALLEPPERPYRDREPHGYSPERLRGELERARAPHLPPAAPALDGALLPSLGALHFPRLSPAA    911 - 980
LHNGLLARTPPAAAALGAPPPLVTAAGPPTPPGPPRSRTTPLGGLGPGEARDYSPSRNPPEVEAR         981 - 1045
//

Text Mined References (11)

PMID Year Title