Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.500 6.5e-03
posterior fossa group A ependymoma -2.400 5.1e-17
atypical teratoid / rhabdoid tumor -1.500 2.5e-03
medulloblastoma, large-cell -1.100 7.5e-04
pediatric high grade glioma -1.200 7.6e-03
subependymal giant cell astrocytoma -1.619 3.2e-02
inflammatory breast cancer -2.200 3.0e-04
lung carcinoma 1.600 6.6e-39

AA Sequence

MKSAASSRGGGGGGRGGGGWGSWGGGRGGGGGAGKGGGGDGGGQGGKGGFGARARGFGGGGRGRGRGGGD      1 - 70
GKDRGGGGQRRGGVAKSKSRRRKGAMVVSVEPHRHEGVFIYRGAEDALVTLNMVPGQSVYGERRVTVTEG     71 - 140
GVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGR    141 - 210
DLVNVAKKRTNIIPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANC    211 - 280
IDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRPLPKSSSK                    281 - 334
//

Text Mined References (2)

PMID Year Title
24639526 2014 RSPO-LGR4 functions via IQGAP1 to potentiate Wnt signaling.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.