Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.84
PubTator Score 6.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cytochrome-c Oxidase Deficiency 17 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 329 0.0 1.0
Disease Target Count Z-score Confidence
Mitochondrial encephalomyopathy 15 5.061 2.5

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.300 1.1e-13
ependymoma 1.300 2.2e-02
glioblastoma 1.100 7.5e-03
non primary Sjogren syndrome sicca -1.200 1.2e-02
ovarian cancer 1.400 1.5e-04
sonic hedgehog group medulloblastoma 1.100 1.7e-05

Gene RIF (7)

AA Sequence

MLTTLKPFGSVSVESKMNNKAGSFFWNLRQFSTLVSTSRTMRLCCLGLCKPKIVHSNWNILNNFHNRMQS      1 - 70
TDIIRYLFQDAFIFKSDVGFQTKGISTLTALRIERLLYAKRLFFDSKQSLVPVDKSDDELKKVNLNHEVS     71 - 140
NEDVLTKETKPNRISSRKLSEECNSLSDVLDAFSKAPTFPSSNYFTAMWTIAKRLSDDQKRFEKRLMFSH    141 - 210
PAFNQLCEHMMREAKIMQYKYLLFSLHAIVKLGIPQNTILVQTLLRVTQERINECDEICLSVLSTVLEAM    211 - 280
EPCKNVHVLRTGFRILVDQQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFE    281 - 350
VLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQYHNLDLFKGLADYVAATFDIWKFRKVL    351 - 420
FILILFENLGFRPVGLMDLFMKRIVEDPESLNMKNILSILHTYSSLNHVYKCQNKEQFVEVMASALTGYL    421 - 490
HTISSENLLDAVYSFCLMNYFPLAPFNQLLQKDIISELLTSDDMKNAYKLHTLDTCLKLDDTVYLRDIAL    491 - 560
SLPQLPRELPSSHTNAKVAEVLSSLLGGEGHFSKDVHLPHNYHIDFEIRMDTNRNQVLPLSDVDTTSATD    561 - 630
IQRVAVLCVSRSAYCLGSSHPRGFLAMKMRHLNAMGFHVILVNNWEMDKLEMEDAVTFLKTKIYSVEALP    631 - 700
VAAVNVQSTQ                                                                701 - 710
//

Text Mined References (26)

PMID Year Title