Property Summary

NCBI Gene PubMed Count 41
PubMed Score 47.41
PubTator Score 37.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Anemia 353 5.535 2.8
Bloom syndrome 29 3.515 1.8
Cancer 2388 3.033 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma 2.152 5.7e-06
adult high grade glioma 2.000 1.0e-04
Astrocytoma, Pilocytic 1.100 9.6e-06
Atopic dermatitis 1.700 6.2e-07
atypical teratoid / rhabdoid tumor 2.100 8.8e-09
Breast cancer 2.900 4.0e-02
breast carcinoma 1.400 2.5e-05
colon cancer 1.100 2.1e-02
ductal carcinoma in situ 1.800 8.5e-04
Endometriosis 1.507 1.5e-02
ependymoma 1.200 4.9e-05
glioblastoma 2.700 3.2e-09
group 3 medulloblastoma 3.200 1.5e-06
intraductal papillary-mucinous carcinoma... 2.300 3.7e-04
intraductal papillary-mucinous neoplasm ... 2.700 1.1e-03
invasive ductal carcinoma 2.300 3.0e-04
lung adenocarcinoma 1.900 3.0e-10
lung cancer 2.100 2.0e-03
malignant mesothelioma 1.500 3.1e-07
medulloblastoma, large-cell 2.200 6.0e-06
nasopharyngeal carcinoma 1.300 1.6e-06
non-small cell lung cancer 2.685 1.1e-27
ovarian cancer 1.100 3.7e-03
pancreatic cancer 1.300 2.3e-05
pituitary cancer 1.400 3.4e-05
primary Sjogren syndrome 1.100 1.5e-02
primitive neuroectodermal tumor 2.900 2.4e-06
psoriasis 1.100 1.1e-25
ulcerative colitis 1.300 2.1e-06

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (26)

AA Sequence

MDQKILSLAAEKTADKLQEFLQTLREGDLTNLLQNQAVKGKVAGALLRAIFKGSPCSEEAGTLRRRKIYT      1 - 70
CCIQLVESGDLQKEIASEIIGLLMLEAHHFPGPLLVELANEFISAVREGSLVNGKSLELLPIILTALATK     71 - 140
KENLAYGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSMFKDVPLTAEEVEFVVEKALSMFSKMNLQEI    141 - 210
PPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDELLDVVTVPSGELRHVEGTIILHIVFAIK    211 - 280
LDYELGRELVKHLKVGQQGDSNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFL    281 - 350
QNLVPHRSYVSTMILEVVKNSVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPSLSRMPNQHACK    351 - 420
LGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHFLDLLSNIVMYAPLVLQSCSSKVTEAFDYLSF    421 - 490
LPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGFLLLLKNFKVLGSLSSSQCSQ    491 - 560
SLSVSQVHVDVHSHYNSVANETFCLEIMDSLRRCLSQQADVRLMLYEGFYDVLRRNSQLANSVMQTLLSQ    561 - 630
LKQFYEPKPDLLPPLKLEACILTQGDKISLQEPLDYLLCCIQHCLAWYKNTVIPLQQGEEEEEEEEAFYE    631 - 700
DLDDILESITNRMIKSELEDFELDKSADFSQSTSIGIKNNICAFLVMGVCEVLIEYNFSISSFSKNRFED    701 - 770
ILSLFMCYKKLSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALFRDSIQSHQESLSVLRSSNEFMR    771 - 840
YAVNVALQKVQQLKETGHVSGPDGQNPEKIFQNLCDITRVLLWRYTSIPTSVEESGKKEKGKSISLLCLE    841 - 910
GLQKIFSAVQQFYQPKIQQFLRALDVTDKEGEEREDADVSVTQRTAFQIRQFQRSLLNLLSSQEEDFNSK    911 - 980
EALLLVTVLTSLSKLLEPSSPQFVQMLSWTSKICKENSREDALFCKSLMNLLFSLHVSYKSPVILLRDLS    981 - 1050
QDIHGHLGDIDQDVEVEKTNHFAIVNLRTAAPTVCLLVLSQAEKVLEEVDWLITKLKGQVSQETLSEEAS   1051 - 1120
SQATLPNQPVEKAIIMQLGTLLTFFHELVQTALPSGSCVDTLLKDLCKMYTTLTALVRYYLQVCQSSGGI   1121 - 1190
PKNMEKLVKLSGSHLTPLCYSFISYVQNKSKSLNYTGEKKEKPAAVATAMARVLRETKPIPNLIFAIEQY   1191 - 1260
EKFLIHLSKKSKVNLMQHMKLSTSRDFKIKGNILDMVLREDGEDENEEGTASEHGGQNKEPAKKKRKK     1261 - 1328
//

Text Mined References (48)

PMID Year Title