Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.4e-05

 Compartment GO Term (0)

AA Sequence

MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSP      1 - 70
KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGL     71 - 140
KEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK                                     141 - 177
//

Text Mined References (5)

PMID Year Title