Property Summary

NCBI Gene PubMed Count 13
PubMed Score 39.42
PubTator Score 33.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (5)

PMID Text
26652654 NMR-derived secondary chemical shifts and relaxation properties show that the Chica LC8 binding domain is essentially disordered with a dynamically restricted segment in one linker between motifs.
26125229 upregulation of FAM83D, a potential oncotarget gene, may be triggered by epigenetic events and can contribute to hepatocarcinogenesis
25646692 Taken together, these results demonstrate that FAM83D is a novel oncogene in HCC development and may constitute a potential therapeutic target in HCC.
24344117 Results demonstrate that FAM83D has prognostic value for breast cancer patients and is a novel oncogene in breast cancer development that at least in part acts through mTOR hyper-activation by inhibiting FBXW7.
18485706 interaction partner of the chromokinesin Kid that is required for the generation of polar ejection forces and chromosome congression

AA Sequence

MALLSEGLDEVPAACLSPCGPPNPTELFSESRRLALEELVAGGPEAFAAFLRRERLARFLNPDEVHAILR      1 - 70
AAERPGEEGAAAAAAAEDSFGSSHDCSSGTYFPEQSDLEPPLLELGWPAFYQGAYRGATRVETHFQPRGA     71 - 140
GEGGPYGCKDALRQQLRSAREVIAVVMDVFTDIDIFRDLQEICRKQGVAVYILLDQALLSQFLDMCMDLK    141 - 210
VHPEQEKLMTVRTITGNIYYARSGTKIIGKVHEKFTLIDGIRVATGSYSFTWTDGKLNSSNLVILSGQVV    211 - 280
EHFDLEFRILYAQSKPISPKLLSHFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEM    281 - 350
PAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAIDAATQTEPGEEMPGLSVSEVGTQTSITTACAGT    351 - 420
QTAVITRIASSQTTIWSRSTTTQTDMDENILFPRGTQSTEGSPVSKMSVSRSSSLKSSSSVSSQGSVASS    421 - 490
TGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHL    491 - 560
GLHSGNFSRVNLLAVRDVALYPSYQ                                                 561 - 585
//

Text Mined References (17)

PMID Year Title
26652654 2016 The Anchored Flexibility Model in LC8 Motif Recognition: Insights from the Chica Complex.
26125229 2015 Upregulation of FAM83D affects the proliferation and invasion of hepatocellular carcinoma.
25646692 2015 FAM83D activates the MEK/ERK signaling pathway and promotes cell proliferation in hepatocellular carcinoma.
24736947 2014 Conserved oncogenic behavior of the FAM83 family regulates MAPK signaling in human cancer.
24344117 2013 FAM83D promotes cell proliferation and motility by downregulating tumor suppressor gene FBXW7.
23205133 2012 Meta-analysis of the expression of the mitosis-related gene Fam83D.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18485706 2008 The spindle protein CHICA mediates localization of the chromokinesin Kid to the mitotic spindle.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15561729 2005 Proteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.