Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Seminoma 15 4.172 2.1
Testicular cancer 25 3.979 2.0

Expression

Gene RIF (1)

AA Sequence

MSKIRGLPPEVREPGPGVELGVENGLLCQLIHSPEFNLFSNSVVFESNFIQTHVPEADFQVTKPGNWRDV      1 - 70
CEGSATVILGVTSSVPSLPLPNVLLMANVTWPQGPFTTWSTPGDAPVINLSRLLPLKYVELRIYDRLQRI     71 - 140
LRVRTVTEKIYYLKLHEKHPEIVFQFWVRLVKILQKGLSITTKDPRIKFTHCLVPKMPTNSTETTPENSL    141 - 210
LSSPQPSEPLVLLAAEQTSGSFSQLSGKPQLTADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALS    211 - 280
HSLWEQEDWNEHLLQVHIASYLGEHFLGA                                             281 - 309
//

Text Mined References (5)

PMID Year Title