Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
osteosarcoma -4.443 1.5e-05
glioblastoma 1.500 1.7e-03
adrenocortical adenoma -1.451 2.5e-02
adrenocortical carcinoma -2.928 4.9e-11
interstitial cystitis 2.400 6.0e-06
pediatric high grade glioma 1.500 9.8e-05
pilocytic astrocytoma 1.800 4.8e-09
psoriasis 1.600 1.2e-08
Breast cancer 1.400 1.2e-04
invasive ductal carcinoma -1.100 7.6e-03
ulcerative colitis 1.700 1.3e-04
ovarian cancer -1.500 7.6e-05

Gene RIF (1)

20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LSFGEKGRLAFEKMDKLCSEQREVFCQEADVEITIF                                      911 - 946

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.