Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available



  Differential Expression (12)

Disease log2 FC p
adrenocortical adenoma -1.451 2.5e-02
adrenocortical carcinoma -2.928 4.9e-11
adult high grade glioma 1.100 8.9e-04
Astrocytoma, Pilocytic 1.800 1.9e-08
Breast cancer 1.400 1.2e-04
glioblastoma 1.300 2.6e-03
interstitial cystitis 1.200 2.9e-02
invasive ductal carcinoma -1.100 7.6e-03
osteosarcoma -4.443 1.5e-05
ovarian cancer -1.500 7.6e-05
psoriasis 1.600 1.2e-08
ulcerative colitis 1.700 1.3e-04

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

LSFGEKGRLAFEKMDKLCSEQREVFCQEADVEITIF                                      911 - 946

Text Mined References (7)

PMID Year Title