Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.34
PubTator Score 7.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-02
aldosterone-producing adenoma 2.236 6.9e-03
astrocytic glioma -1.200 2.7e-02
Astrocytoma, Pilocytic -1.400 3.6e-05
ependymoma -1.200 4.4e-02
glioblastoma -1.200 5.4e-05
lung carcinoma 1.100 2.0e-13
oligodendroglioma -1.200 2.9e-02
sonic hedgehog group medulloblastoma -1.200 1.3e-02

Gene RIF (8)

AA Sequence

MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEER      1 - 70
SQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR     71 - 140
//

Text Mined References (15)

PMID Year Title