Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.48
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 2.7e-02
ependymoma -1.400 1.0e-11
oligodendroglioma -1.200 2.9e-02
glioblastoma -1.200 5.4e-05
pediatric high grade glioma -1.200 2.5e-03
pilocytic astrocytoma -1.400 5.7e-05
sonic hedgehog group medulloblastoma -1.200 1.3e-02
aldosterone-producing adenoma 2.236 6.9e-03
lung carcinoma 1.100 2.0e-13

Gene RIF (6)

PMID Text
26317579 among high risk HPV-positive women from an outpatient population aged >/= 30 years, methylation analysis of FAM19A4 is an attractive marker for the identification of women with high-grade cervical intraepithelial neoplasia and cervical cancer
25281488 High methylation of FAM19A4 is associated with cervical carcinomas.
25109685 FAM19A4 is a novel ligand of formyl peptide receptor 1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEER      1 - 70
SQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR     71 - 140
//

Text Mined References (13)

PMID Year Title
26317579 2016 Comparing the performance of FAM19A4 methylation analysis, cytology and HPV16/18 genotyping for the detection of cervical (pre)cancer in high-risk HPV-positive women of a gynecologic outpatient population (COMETH study).
25416956 2014 A proteome-scale map of the human interactome network.
25281488 2014 Methylation analysis of the FAM19A4 gene in cervical scrapes is highly efficient in detecting cervical carcinomas and advanced CIN2/3 lesions.
25109685 2015 FAM19A4 is a novel cytokine ligand of formyl peptide receptor 1 (FPR1) and is able to promote the migration and phagocytosis of macrophages.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028294 2004 TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.