Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma -1.100 5.6e-03
oligodendroglioma 1.500 3.7e-03
astrocytoma 1.300 1.7e-19
sonic hedgehog group medulloblastoma -2.500 1.5e-06
medulloblastoma, large-cell -2.200 4.1e-05
interstitial cystitis -1.900 9.8e-06
posterior fossa group B ependymoma 1.600 2.5e-07
non-inflammatory breast cancer -1.100 6.1e-05
pituitary cancer 2.000 3.5e-07

AA Sequence

MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALDKGCCFEDDETGAPAGALLSGAEGGDVREATRDLLSFI      1 - 70
DSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGAAPPGPPSPSAADTPAKRPLAAPSAPTVAAP     71 - 140
AHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGAEPAGGEVAAPAAGLGGAGTGGAGGDVAGPAG    141 - 210
ATAIPGARKVPLRARNLPPSFFTEPSRAGGGGCGPSGPDVSLGDLEKGAEAVEFFELLGPDYGAGTEAAV    211 - 280
LLAAEPLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPL    281 - 350
SPLYPAAADSPGGEDGRGHLASFAPFFPDCALPPPPPPHQVSYDYSAGYSRTAYSSLWRSDGVWEGAPGE    351 - 420
EGAHRD                                                                    421 - 426
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.