Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 2.2e-13
interstitial cystitis -1.700 2.9e-04
medulloblastoma -1.600 7.8e-04
medulloblastoma, large-cell -1.400 2.1e-05
non-inflammatory breast cancer -1.100 6.1e-05
oligodendroglioma 1.500 3.7e-03
pituitary cancer 2.000 3.5e-07
posterior fossa group A ependymoma 1.100 6.0e-05
urothelial carcinoma -1.100 5.6e-03

 Compartment GO Term (2)

AA Sequence

MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALDKGCCFEDDETGAPAGALLSGAEGGDVREATRDLLSFI      1 - 70
DSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGAAPPGPPSPSAADTPAKRPLAAPSAPTVAAP     71 - 140
AHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGAEPAGGEVAAPAAGLGGAGTGGAGGDVAGPAG    141 - 210
ATAIPGARKVPLRARNLPPSFFTEPSRAGGGGCGPSGPDVSLGDLEKGAEAVEFFELLGPDYGAGTEAAV    211 - 280
LLAAEPLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPL    281 - 350
SPLYPAAADSPGGEDGRGHLASFAPFFPDCALPPPPPPHQVSYDYSAGYSRTAYSSLWRSDGVWEGAPGE    351 - 420
EGAHRD                                                                    421 - 426
//

Text Mined References (5)

PMID Year Title