Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.37
PubTator Score 6.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.100 1.6e-03
tuberculosis 2.200 1.5e-09
intraductal papillary-mucinous adenoma (... 1.300 9.4e-03
diabetes mellitus -1.100 2.8e-03
invasive ductal carcinoma -1.100 4.6e-03
ovarian cancer -1.400 2.1e-07

Synonym

Accession Q8WUF8 B2R7C6 B4DJ14 B4DLG5 Q9H0U8
Symbols C5orf21

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
26676844 Our results showed that FAM172A could suppress proliferation of colon cancer cells, and STAT1 could bind to the minimum promoter region of FAM172A and upregulated the expression of FAM172A
26573560 FAM172A protein is expressed at high levels in human papillary thyroid carcinoma, which may promote cell proliferation via activation of the p38 MAPK signaling pathway.
23314443 FAM172A may be a novel tumor-suppressor gene that plays an important role in cell cycle mediated, at least partially, by the Notch 3 signaling pathway.
21092515 FAM172A protein promotes cell proliferation, inhibits cell apoptosis and facilitates S-phase entry in HEK293 cells.
20818486 FAM172 protein expression in human aortic smooth muscle cells was up-regulated by high glucose levels in a concentration-dependent and time-course manner.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20137623 The changes of C5orf21 gene expression are correlated with diabetic macroangiopathy.
18854154 Knockdown of family with sequence similarity 172, member A (C5orf21; FAM172A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEK      1 - 70
GQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKSFIFMS     71 - 140
EDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVLNPNENYIEVEKPK    141 - 210
IHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIA    211 - 280
QAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS    281 - 350
EPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL        351 - 416
//

Text Mined References (18)

PMID Year Title
26676844 2016 FAM172A modulates apoptosis and proliferation of colon cancer cells via STAT1 binding to its promoter.
26573560 2016 FAM172A protein promotes the proliferation of human papillary thyroid carcinoma cells via the p38 mitogen-activated protein kinase pathway.
23314443 2013 FAM172A induces S phase arrest of HepG2 cells via Notch 3.
21092515 2010 [Effect of FAM172A protein on apoptosis and proliferation in HEK293 cells].
20818486 2010 Identification of the novel protein FAM172A, and its up-regulation by high glucose in human aortic smooth muscle cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20137623 2009 [Molecular cloning of a novel gene, C5orf21 gene and its roles in diabetic macroangiopathy].
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.