Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
ependymoma -2.000 3.6e-02
oligodendroglioma -1.600 4.0e-02
glioblastoma -2.100 3.0e-04
medulloblastoma -2.200 1.4e-06
cystic fibrosis 1.413 6.1e-06
atypical teratoid / rhabdoid tumor -1.800 9.5e-03
medulloblastoma, large-cell -3.000 6.3e-06
primitive neuroectodermal tumor -1.500 2.2e-02
Atopic dermatitis -1.400 1.7e-03
adrenocortical carcinoma -1.721 7.2e-03
non-small cell lung cancer 1.016 3.9e-07
intraductal papillary-mucinous adenoma (... -1.900 3.5e-03
intraductal papillary-mucinous carcinoma... -1.800 6.2e-03
sarcoidosis 1.300 9.5e-03
pediatric high grade glioma -1.300 4.0e-03
psoriasis -1.200 1.6e-09
lung carcinoma 4.700 1.3e-46
Breast cancer -1.500 9.1e-04
ulcerative colitis 1.200 6.1e-03
ovarian cancer -2.500 2.1e-05

AA Sequence

MARLCRRVPCTLLLGLAVVLLKARLVPAAARAELSRSDLSLIQQQQQQQQQQQQQQKQLEEAEEERTEVP      1 - 70
GATSTLTVPVSVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSNGAVLIKVPYKLGLSLTIIAY     71 - 140
KDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDTVLITGKLADAKSQPSVQFSKALIKLPDNHH    141 - 210
ISNVTGYLTVLQQFLKVDNFLHTTGITLNKPGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRL    211 - 280
NDISAGDRIPAWTFDMNTGAWVNHGRGMVKEHNNHLIWTYDAPHLGYWIAAPLPGTRGSGINEDSKDITA    281 - 350
YHTVFLTAILGGTIVIVIGFFAVLLCYCRDKCGTPQKRERNITKLEVLKRDQTTSTTHINHISTVKVALK    351 - 420
AEDKSQLFNAKNSSYSPQKKEPSKAETEERVSMVKTRDDFKIYNEDVSFLSVNQNNYSRNPTQSLEPNVG    421 - 490
SKQPKHINNNLSSSLGDAQDEKRYLTGNEEAYGRSHIPEQLMHIYSQPIAILQTSDLFSTPEQLHTAKSA    491 - 560
TLPRKGQLVYGQLMEPVNRENFTQTLPKMPIHSHAQPPDAREEDIILEGQQSLPSQASDWSRYSSSLLES    561 - 630
VSVPGTLNEAVVMTPFSSELQGISEQTLLELSKGKPSPHPRAWFVSLDGKPVAQVRHSFIDLKKGKRTQS    631 - 700
NDTSLDSGVDMNELHSSRKLEREKTFIKSMHQPKILYLEDLDLSSSESGTTVCSPEDPALRHILDGGSGV    701 - 770
IMEHPGEESPGRKSTVEDFEANTSPTKRRGRPPLAKRDSKTNIWKKREERPLIPIN                  771 - 826
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.