Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Azoospermia 110 3.925 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.205 6.6e-05
adult high grade glioma -1.500 2.3e-05
glioblastoma -1.200 1.9e-03
medulloblastoma, large-cell -1.900 3.5e-04
osteosarcoma -1.537 4.3e-06
ovarian cancer -2.300 5.5e-09
pancreatic cancer 1.300 1.1e-02
pancreatic ductal adenocarcinoma liver m... -1.455 5.8e-03

AA Sequence

MFSKFTSILQHAVEALAPSLPLQEDFVYHWKAITHYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENER      1 - 70
ESGETGPCMEYLLHHKILETLYTLGKADCPPGMKQQVLVFYTKLLGRIRQPLLPHINVHRPVQKLIRLCG     71 - 140
EVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQP    141 - 210
EELSGATGMEQTELEDEPPHQMDHLSTSLDNLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKA    211 - 280
CEGLMLLVSLPEPAAAKCLTQSTCLCELLTDRLASLYKALPQSVDPLDIETVEAINWGLDSYSHKEDASA    281 - 350
FPGKRALISFLSWFDYCDQLIKEAQKTAAVALAKAVHERFFIGVMEPQLMQTSEMGILTSTALLHRIVRQ    351 - 420
VTSDVLLQEMVFFILGEQREPETLAEISRHPLRHRLIEHCDHISDEISIMTLRMFEHLLQKPNEHILYNL    421 - 490
VLRNLEERNYTEYKPLCPEDKDVVENGLIAGAVDLEEDPLFTDISPENTLPNQEWLSSSPPATPDHPKND    491 - 560
GKTEVHKIVNSFLCLVPDDAKSSYHVEGTGYDTYLRDAHRQFRDYCAICLRWEWPGSPKALEKCNLEAAF    561 - 630
FEGHFLKVLFDRMGRILDQPYDVNLQVTSVLSRLSLFPHPHIHEYLLDPYVNLAPGCRSLFSVIVRVVGD    631 - 700
LMLRIQRIQDFTPKLLLVRKRLLGLEPEGPIIDHITLLEGVIVLEEFCKELAAIAFVKYHASSTP         701 - 765
//

Text Mined References (7)

PMID Year Title