Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 1.9e-26

Expression

Synonym

Accession C9JC47
Symbols GTF2IP18

Gene

 Compartment GO Term (1)

AA Sequence

MGPLFTTIPGAHSGPMRPLPKKHVEPMAVRQLLLGNSTMIRHTCPMSVPLSRQVKEVAAQKPSEDIYKNW      1 - 70
QQQQQQQQQQQQQQLDLLFHQRIQISLWPRKQKRRKTEQHSHPFVKKAFRFSAGSGCGRPSSNKMLRSMG     71 - 140
GGQRPTGLGSEFFRLLHDLHLLAFAMKRIWIHRRGEATARPRAPEHPAPPATAVRGRDAASQNLKRRPGS    141 - 210
GTDGLRLQGAEPSRLLRTYAGGAVIPTGTPERAQPPPPQDPLGRRRWLSRNTWGPWPGTTQPPSPQLLRN    211 - 280
DWGSCGFMVPEAARGKVFQDSQEGAHIRRETVSKSVCAEPWRHQRARDPAPTNFPLRCQKQRGASASSGQ    281 - 350
HEGRVNLVFFIGSPTVIAVPDLQCPTKYSGMLY                                         351 - 383
//

Text Mined References (1)

PMID Year Title