Protein FAM131C

Property Summary

NCBI Gene PubMed Count	9
PubMed Score	0.07

PubTator Score	0.07

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Brain - Cerebellum 17,983

Brain - Cerebellar Hemisphere 18,015

Brain - Spinal cord (cervical c-1) 17,973

Brain - Substantia nigra 17,981

Brain - Hypothalamus 18,169

Brain - Anterior cingulate cortex (BA24) 17,989

Adrenal Gland 18,071

Brain - Cortex 18,039

Pituitary 18,147

Brain - Frontal Cortex (BA9) 18,069

Brain - Amygdala 18,006

Brain - Hippocampus 18,011

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Putamen (basal ganglia) 17,863

Brain - Caudate (basal ganglia) 18,001

Skin - Sun Exposed (Lower leg) 17,968

Heart - Atrial Appendage 17,896

Kidney - Cortex 17,329

Skin - Not Sun Exposed (Suprapubic) 18,081

Thyroid 18,024

Esophagus - Mucosa 18,076

Heart - Left Ventricle 18,006

Testis 18,518

Uterus 17,618

Vagina 17,834

Stomach 17,879

Minor Salivary Gland 18,005

Pancreas 18,123

Artery - Aorta 17,896

Ovary 17,971

Artery - Coronary 17,949

Colon - Sigmoid 18,089

Esophagus - Muscularis 18,017

Esophagus - Gastroesophageal Junction 18,000

Prostate 18,213

Artery - Tibial 17,631

Adipose - Subcutaneous 18,110

Nerve - Tibial 18,007

Breast - Mammary Tissue 18,103

Small Intestine - Terminal Ileum 17,954

Adipose - Visceral (Omentum) 17,937

Cells - Transformed fibroblasts 17,577

Spleen 17,614

Colon - Transverse 17,825

Cells - EBV-transformed lymphocytes 18,186

Lung 18,057

Liver 18,071

Muscle - Skeletal 17,778

Whole Blood 17,439

adrenal gland 15,963

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

prostate 16,460

salivary gland 14,981

seminal vesicle 15,918

skin 16,206

small intestine 16,154

smooth muscle 15,857

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

See source...

See source...

Synonym

Accession	Q96AQ9 Q5T5Q5 Q8N3X3 Q8N9P9
Symbols	C1orf117

Gene

FAM131C

Ortholog (9)

Species	Source	Disease
Macaque 12,758	OMA EggNOG
Mouse 16,567	Inparanoid OMA EggNOG
Rat 15,112	OMA EggNOG
Horse 14,249	Inparanoid OMA EggNOG
Cow 15,316	Inparanoid OMA EggNOG
Pig 10,164	OMA EggNOG
Opossum 12,223	Inparanoid OMA EggNOG
Platypus 5,699	Inparanoid EggNOG
Anole lizard 10,585	Inparanoid EggNOG

UniProt Keyword (3)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Compartment GO Term (4)

Cytosol 6,686

Intermediate filaments 154

Nucleoli 942

cellular_component 18,320

GWAS Trait (1)

Cognitive performance 79

HCA RNA Cell Line (43)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

CACO-2 15,436

CAPAN-2 16,102

See all...

AA Sequence

MGSCVSRDLFTSAHKNCPMPQGADPLNPDLPSGRTPTVAPDCVIGKDKQMDFCWDPWQRCFQTTNGYLSD      1 - 70
SRSRPGNYNVAALATSSLVGVVQSIKDHITKPTAMARGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLP     71 - 140
DELREARFAAGVAEQFAITEATLSAWSSLDEEELHPENSPQGIVQLQDLESIYLQDSLPSGPSQDDSLQA    141 - 210
FSSPSPSPDSCPSPEEPPSTAGIPQPPSPELQHRRRLPGAQGPEGGTHPPGSLPSMDSGSLWEEDEVFYN    211 - 280
//

Text Mined References (9)

Summary
Details

	PMID	Year	Title