Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.700 1.8e-03
oligodendroglioma -1.300 1.8e-18
psoriasis -1.100 4.1e-03
glioblastoma -2.100 3.9e-05
osteosarcoma -1.206 1.7e-04
medulloblastoma -2.000 1.9e-07
atypical teratoid / rhabdoid tumor -2.500 5.6e-07
medulloblastoma, large-cell -3.000 5.1e-06
primitive neuroectodermal tumor -1.600 5.7e-03
adult high grade glioma -2.300 1.1e-04
pilocytic astrocytoma -1.900 1.9e-06
posterior fossa group A ependymoma -1.100 2.5e-05
subependymal giant cell astrocytoma -1.800 3.0e-02
Pick disease -1.200 9.7e-04
ovarian cancer 1.200 1.8e-04

Synonym

Accession Q6UXB0 D3DNT6 G5E9B1 Q8TA84
Symbols C3orf40
FLAT715
PRO1378

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MFLATLSFLLPFAHPFGTVSCEYMLGSPLSSLAQVNLSPFSHPKVHMDPNYCHPSTSLHLCSLAWSFTRL      1 - 70
LHPPLSPGISQVVKDHVTKPTAMAQGRVAHLIEWKGWSKPSDSPAALESAFSSYSDLSEGEQEARFAAGV     71 - 140
AEQFAIAEAKLRAWSSVDGEDSTDDSYDEDFAGGMDTDMAGQLPLGPHLQDLFTGHRFSRPVRQGSVEPE    141 - 210
SDCSQTVSPDTLCSSLCSLEDGLLGSPARLASQLLGDELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLT    211 - 280
ESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSLDEDEAEPEEQ                   281 - 335
//

Text Mined References (6)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.