Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.900 1.8e-04
astrocytic glioma -1.700 1.8e-03
Astrocytoma, Pilocytic -1.900 1.8e-06
atypical teratoid / rhabdoid tumor -2.500 5.6e-07
glioblastoma -1.400 1.7e-05
group 3 medulloblastoma -1.100 4.5e-02
medulloblastoma, large-cell -3.000 5.1e-06
oligodendroglioma -1.100 8.4e-03
osteosarcoma -1.206 1.7e-04
ovarian cancer 1.200 1.8e-04
Pick disease -1.100 2.7e-03
posterior fossa group A ependymoma -1.100 2.5e-05
primitive neuroectodermal tumor -1.600 5.7e-03
psoriasis -1.100 4.1e-03
subependymal giant cell astrocytoma -1.800 3.0e-02

AA Sequence

MFLATLSFLLPFAHPFGTVSCEYMLGSPLSSLAQVNLSPFSHPKVHMDPNYCHPSTSLHLCSLAWSFTRL      1 - 70
LHPPLSPGISQVVKDHVTKPTAMAQGRVAHLIEWKGWSKPSDSPAALESAFSSYSDLSEGEQEARFAAGV     71 - 140
AEQFAIAEAKLRAWSSVDGEDSTDDSYDEDFAGGMDTDMAGQLPLGPHLQDLFTGHRFSRPVRQGSVEPE    141 - 210
SDCSQTVSPDTLCSSLCSLEDGLLGSPARLASQLLGDELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLT    211 - 280
ESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSLDEDEAEPEEQ                   281 - 335
//

Text Mined References (6)

PMID Year Title