Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.86
PubTator Score 12.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cholestasis 155 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Thyroid adenoma 10 3.995 2.0
Thyroid cancer 36 3.209 1.6
Pineoblastoma 6 3.185 1.6

Expression

  Differential Expression (34)

Disease log2 FC p
acute myeloid leukemia 1.100 2.4e-02
adult high grade glioma 2.400 2.2e-06
aldosterone-producing adenoma -1.181 3.1e-02
Astrocytoma, Pilocytic 1.400 3.6e-06
atypical teratoid / rhabdoid tumor 1.500 2.8e-03
Breast cancer -1.600 8.8e-04
breast carcinoma -1.200 2.5e-21
chronic kidney disease 1.300 1.8e-02
chronic lymphosyte leukemia -1.600 4.0e-09
colon cancer -3.000 1.8e-03
dermatomyositis 2.000 1.8e-03
diabetes mellitus -1.400 5.8e-03
ependymoma 1.600 2.7e-09
glioblastoma 1.700 3.9e-06
group 3 medulloblastoma 1.100 2.5e-02
intraductal papillary-mucinous carcinoma... -4.400 1.2e-04
intraductal papillary-mucinous neoplasm ... -2.200 2.7e-03
invasive ductal carcinoma -1.500 4.3e-02
lung cancer -2.500 2.2e-04
lung carcinoma -1.700 3.7e-17
malignant mesothelioma 1.500 9.4e-05
medulloblastoma, large-cell -1.400 3.3e-03
osteosarcoma -1.422 4.6e-02
ovarian cancer -1.400 9.4e-03
pancreatic cancer -1.300 2.4e-04
Pick disease 1.100 6.7e-04
Polycystic ovary syndrome -2.152 1.3e-02
primary pancreatic ductal adenocarcinoma -1.428 1.3e-04
psoriasis 1.200 4.9e-03
Rheumatoid arthritis 2.100 3.0e-03
subependymal giant cell astrocytoma 3.040 2.6e-03
tuberculosis and treatment for 3 months -1.200 5.4e-05
ulcerative colitis 2.300 3.0e-05
X-linked cerebral adrenoleukodystrophy 1.800 2.2e-02

Gene RIF (6)

AA Sequence

MGGSASSQLDEGKCAYIRGKTEAAIKNFSPYYSRQYSVAFCNHVRTEVEQQRDLTSQFLKTKPPLAPGTI      1 - 70
LYEAELSQFSEDIKKWKERYVVVKNDYAVESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHF     71 - 140
PDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLSDCVRHLNHDYMKQMTFEA    141 - 210
QAFLEAVQFFRQEKGHYGSWEMITGDEIQILSNLVMEELLPTLQTDLLPKMKGKKNDRKRTWLGLLEEAY    211 - 280
TLVQHQVSEGLSALKEECRALTKGLEGTIRSDMDQIVNSKNYLIGKIKAMVAQPAEKSCLESVQPFLASI    281 - 350
LEELMGPVSSGFSEVRVLFEKEVNEVSQNFQTTKDSVQLKEHLDRLMNLPLHSVKMEPCYTKVNLLHERL    351 - 420
QDLKSRFRFPHIDLVVQRTQNYMQELMENAVFTFEQLLSPHLQGEASKTAVAIEKVKLRVLKQYDYDSST    421 - 490
IRKKIFQEALVQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENVYEEILHQILLDETLKVIKEA    491 - 560
AILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARRASAILPGVLGSETLSNEVFQESEEEKQPEV    561 - 630
PSSLAKGESLSLPGPSPPPDGTEQVIISRVDDPVVNPVATEDTAGLPGTCSSELEFGGTLEDEEPAQEEP    631 - 700
EPITASGSLKALRKLLTASVEVPVDSAPVMEEDTNGESHVPQENEEEEEKEPSQAAAIHPDNCEESEVSE    701 - 770
REAQPPCPEAHGEELGGFPEVGSPASPPASGGLTEEPLGPMEGELPGEACTLTAHEGRGGKCTEEGDASQ    771 - 840
QEGCTLGSDPICLSESQVSEEQEEMGGQSSAAQATASVNAEEIKVARIHECQWVVEDAPNPDVLLSHKDD    841 - 910
VKEGEGGQESFPELPSEE                                                        911 - 928
//

Text Mined References (27)

PMID Year Title