Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.39
PubTator Score 12.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (34)

Disease log2 FC p
Rheumatoid Arthritis 2.100 3.0e-03
malignant mesothelioma 1.500 9.4e-05
psoriasis 1.200 4.9e-03
glioblastoma 3.000 1.4e-03
osteosarcoma -1.422 4.6e-02
chronic lymphosyte leukemia -1.600 4.0e-09
ependymoma 1.900 2.1e-07
atypical teratoid/rhabdoid tumor 1.600 2.0e-04
medulloblastoma, large-cell -1.400 3.3e-03
chronic kidney disease 1.300 1.8e-02
tuberculosis and treatment for 6 months -1.500 2.5e-03
primary pancreatic ductal adenocarcinoma -2.979 6.3e-05
intraductal papillary-mucinous carcinoma... -4.800 1.6e-04
intraductal papillary-mucinous neoplasm ... -2.200 2.7e-03
X-linked cerebral adrenoleukodystrophy 1.800 2.2e-02
colon cancer -4.000 1.5e-05
lung cancer -3.800 1.2e-06
pancreatic cancer -2.600 1.9e-04
diabetes mellitus -1.400 5.8e-03
adult high grade glioma 2.600 1.2e-04
group 3 medulloblastoma 1.600 7.9e-03
pilocytic astrocytoma 1.800 1.7e-07
aldosterone-producing adenoma -1.181 3.1e-02
subependymal giant cell astrocytoma 3.372 5.3e-03
Polycystic Ovary Syndrome -2.152 1.3e-02
lung carcinoma -1.700 3.7e-17
breast carcinoma -1.200 2.5e-21
Pick disease 1.100 6.7e-04
Breast cancer -1.800 5.5e-04
invasive ductal carcinoma -1.500 4.3e-02
acute myeloid leukemia 1.100 2.4e-02
ulcerative colitis 2.400 2.0e-04
ovarian cancer -2.500 2.4e-05
dermatomyositis 2.000 1.8e-03

Gene RIF (6)

PMID Text
26317551 Data suggest that decreasing C1orf24 protein levels by restoring microRNA miR-106b function may have therapeutic implications.
22157935 DDIT3, STT3A, ARG2 and FAM129A immunohistochemistry does not appear to be useful in the diagnosis of thyroid follicular neoplasias, as they do not reliably distinguish follicular thyroid carcinoma from follicular thyroid adenoma.
21520112 Gene-expression data suggest a difference in expression between STT3A, Clorf24, and TFF3 in FAs versus carcinomas that may be detected from an FNA sample. Findings must be validated from preoperative FNAs in larger numbers
19536772 The expression of Niban frequently begins in the early stages of head and neck squamous carcinoma and remains upregulated throughout the carcinogenic process. Niban may be a good molecular marker of HNSCC.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16949643 Niban expression is up-regulated in various types of thyroid tumors.

AA Sequence

MGGSASSQLDEGKCAYIRGKTEAAIKNFSPYYSRQYSVAFCNHVRTEVEQQRDLTSQFLKTKPPLAPGTI      1 - 70
LYEAELSQFSEDIKKWKERYVVVKNDYAVESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHF     71 - 140
PDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLSDCVRHLNHDYMKQMTFEA    141 - 210
QAFLEAVQFFRQEKGHYGSWEMITGDEIQILSNLVMEELLPTLQTDLLPKMKGKKNDRKRTWLGLLEEAY    211 - 280
TLVQHQVSEGLSALKEECRALTKGLEGTIRSDMDQIVNSKNYLIGKIKAMVAQPAEKSCLESVQPFLASI    281 - 350
LEELMGPVSSGFSEVRVLFEKEVNEVSQNFQTTKDSVQLKEHLDRLMNLPLHSVKMEPCYTKVNLLHERL    351 - 420
QDLKSRFRFPHIDLVVQRTQNYMQELMENAVFTFEQLLSPHLQGEASKTAVAIEKVKLRVLKQYDYDSST    421 - 490
IRKKIFQEALVQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENVYEEILHQILLDETLKVIKEA    491 - 560
AILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARRASAILPGVLGSETLSNEVFQESEEEKQPEV    561 - 630
PSSLAKGESLSLPGPSPPPDGTEQVIISRVDDPVVNPVATEDTAGLPGTCSSELEFGGTLEDEEPAQEEP    631 - 700
EPITASGSLKALRKLLTASVEVPVDSAPVMEEDTNGESHVPQENEEEEEKEPSQAAAIHPDNCEESEVSE    701 - 770
REAQPPCPEAHGEELGGFPEVGSPASPPASGGLTEEPLGPMEGELPGEACTLTAHEGRGGKCTEEGDASQ    771 - 840
QEGCTLGSDPICLSESQVSEEQEEMGGQSSAAQATASVNAEEIKVARIHECQWVVEDAPNPDVLLSHKDD    841 - 910
VKEGEGGQESFPELPSEE                                                        911 - 928
//

Text Mined References (27)

PMID Year Title
26317551 2015 microRNA-106b-mediated down-regulation of C1orf24 expression induces apoptosis and suppresses invasion of thyroid cancer.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22510990 2012 AKT-dependent phosphorylation of Niban regulates nucleophosmin- and MDM2-mediated p53 stability and cell apoptosis.
22157935 2012 The new molecular markers DDIT3, STT3A, ARG2 and FAM129A are not useful in diagnosing thyroid follicular tumors.
21520112 2011 STT3A, C1orf24, TFF3: putative markers for characterization of follicular thyroid neoplasms from fine-needle aspirates.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19536772 2010 Frequent expression of Niban in head and neck squamous cell carcinoma and squamous dysplasia.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16949643 2006 A novel tumor marker, Niban, is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16444351 2005 [Pathogenesis of differentiated thyroid cancer (papillary and follicular)].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15085203 2004 A preoperative diagnostic test that distinguishes benign from malignant thyroid carcinoma based on gene expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318611 2001 Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus.
11011112 2000 A novel gene "Niban" upregulated in renal carcinogenesis: cloning by the cDNA-amplified fragment length polymorphism approach.