Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.02
PubTator Score 1.00

Knowledge Summary


No data available


  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.800 1.1e-03
Atopic dermatitis 1.100 6.6e-03
ductal carcinoma in situ 2.500 8.2e-04
Endometriosis -2.451 1.3e-02
ependymoma 2.400 1.9e-04
fibroadenoma 1.800 6.6e-03
glioblastoma -2.000 1.9e-03
group 3 medulloblastoma -2.500 1.8e-03
interstitial cystitis -2.400 3.1e-02
invasive ductal carcinoma 2.700 2.5e-03
medulloblastoma, large-cell -2.900 1.3e-03
oligodendroglioma -2.500 5.3e-03
ovarian cancer -2.400 1.3e-04
pediatric high grade glioma -1.600 1.3e-03
pituitary cancer -2.100 8.9e-04
primitive neuroectodermal tumor -2.300 1.9e-02
psoriasis 1.700 5.4e-45

 GO Function (1)

Gene RIF (2)

AA Sequence

PSTTSVIERNARIIKWLYTCKKAKETPSQEQSRTRGSKPSR                                 281 - 321

Text Mined References (5)

PMID Year Title