Property Summary

NCBI Gene PubMed Count 108
PubMed Score 428.73
PubTator Score 294.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
nephrosclerosis -2.083 4.4e-02
pancreatic ductal adenocarcinoma liver m... -3.435 4.8e-02
colon cancer -3.400 3.0e-02
active Crohn's disease -1.051 1.6e-02
active ulcerative colitis -1.322 3.0e-02
psoriasis -1.900 1.8e-05

Synonym

Accession P07148
Symbols FABPL
L-FABP

Gene

PDB

2F73   2L67   2L68   2LKK   2PY1   3B2H   3B2I   3B2J   3B2K   3B2L   3STK   3STM   3STN   3VG2   3VG3   3VG4   3VG5   3VG6   3VG7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (88)

PMID Text
26997447 Loss of staining for LFABP appears to be common in hepatocellular carcinoma and may be seen in well-differentiated hepatocellular carcinoma.
26650609 In the association of SNPs in FABP1 gene with PCOS, rs2197076 was more closely associated with its main features than rs2241883 and seemed to play a more important role in the pathogenesis of PCOS.
26637457 In this study, the effects of hepatitis B virus X protein (HBx) mediated FABP1 regulation on hepatic steatosis and the underlying mechanism were determined.
26585768 Urinary L-FABP appears to be a sensitive biomarker of acute kidney injury in patients undergoing abdominal aortic repair.
26439934 compared with the rs2919872 G allele, the rs2919872 A allele reduces the transcriptional activity of FABP1 promoter, and thereby may link FABP1 gene variation to triglyceride level in humans.
26324091 Urinary levels of NGAL are more sensitive than uKIM-1 and uL-FABP levels in predicting renal scarring in vesicoureteral reflux.
26254248 Higher urinary L-FABP was found in pregnant with and without gestational diabetes mellitus(GDM), and considerably higher urinary L-FABP was found in the GDM group compared with the non-GDM group.
26067610 Multivariable regression analysis revealed that urinary L-FABP and urinary albumin/ creatinine ratio were significantly associated with urinary ACE2 levels.
26010898 Urinary L-FABP is strongly associated with anemia in non-diabetic patients.
25847235 FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner
25797895 L-FABP is a novel biomarker of diverse kidney diseases. (Review)
25732850 The human FABP1 T94A variant protein had 3-fold higher cholesterol-binding affinity than the WT FABP1.
25663234 Both the MTP I128T and the L-FABP T94A polymorphisms can affect serum lipid levels in the Chinese population.
25516669 In smaller HCC, L-FABP downregulation probably occurs because of phenotypic changes during tumor progression. Moreover, this downregulation correlated with tumor differentiation and intratumoral inflammation.
25436304 L-FABP was downregulated in hepatocellular carcinoma and was associated with poor prognosis.
25399315 Maternal serum LFABP level appears to be correlated with the severity of the preeclampsia and can be used to confirm the diagnosis.
25370009 Report interaction of perfluoroalkyl acids with human liver fatty acid-binding protein.
25338211 There is not a significant association between the FABP1 polymorphisms and aspirin-exacerbated respiratory disease(AERD).
25324448 I-FABP and L-FABP are early markers for abdominal injury with limited prognostic value for secondary organ failures in the post-traumatic course
25198387 The study investigates the interaction of L-FAB with phospholipid liposomes.
25027586 Urinary L-FABP was an accurate predictor of early renal allograft function.
24875102 Human FABP1 T94A variant impacts fatty acid metabolism and PPAR-alpha activation in cultured human female hepatocytes.
24750195 Increased serum L-FABP levels are associated with delayed graft function.
24687388 Data suggest that up-regulation of urinary levels of LFABP, KIM1 (kidney injury molecule 1), and NGAL (neutrophil gelatinase associated lipocalin) can be used as biomarkers to reflect tubular dysfunction in early-stage type 2 diabetic nephropathy.
24628888 although the T94A substitution did not alter the affinity of human L-FABP for long chain fatty acids, it significantly altered human L-FABP structure and stability
24626813 Measurement of urinary L-FABP and albumin/creatinine ratio should be useful to assess cardiovascular damage reflecting the elevation of cardiac markers and ECG abnormalities in T2DM with CKD.
24554034 Measurement of uL-FABP levels at 48 h after coronary angiography may be useful in detecting renal damage, and in predicting 1-year renal outcome in ischemic heart disease patients undergoing CAG.
24375576 NGAL, IL-18, KIM-1, L-FABP, and albumin differed between etiologies and were significantly higher in patients adjudicated with acute kidney injury.
24299557 Data suggest that an SNP in FABP1 (T94A) does not alter affinity of FABP1 for PPARalpha agonists (fibrates); this SNP does alter FABP1 secondary structure, stability, and functional response to fibrates (gene expression up-regulation in hepatocytes).
23893635 MS and NMR were used to study the ligand binding of human liver fatty acid binding protein. Results are consistent for 2 binding sites with different affinity; results indicate a higher affinity for oleate relative to palmitate at each binding site.
23604313 Baseline urinary L-FABP levels can be a predictor for occurrence of contrast-induced kidney disease.
23599408 L-FABP was not significantly associated with acute kidney injury in adults or children after adjusting for other kidney injury biomarkers (neutrophil gelatinase-associated lipocalin and IL-18).
23349979 Tubular markers, such as NGAL and L-FABP, may not be predictive factors associated with GFR decline in type 2 diabetic patients.
23291381 patients with chronic hepatitis C had increased levels of L-FABP compared to controls; a strong correlation between serum L-FABP concentrations and aspartate aminotransferases, alanine aminotransferases, HCV RNA levels and hepatic inflammation was found
23223350 results indicate that urinary L-FABP may be a predictive marker for renal and cardiovascular prognosis in type 2 diabetic patients without advanced nephropathy.
23169100 It has investigated the interaction between human L-FABP and the soluble domain of Plasmodium falciparum UIS3 by NMR spectroscopy.
23167703 Urinary L-FABP and NGAL increased at an early stage after cardiac surgery. The combination of the two biomarkers enhanced the accuracy of the early detection of postoperative acute kidney injury after cardiac surgery before a rise in serum creatinine.
23144966 Serum FABP1 correlates positively with obesity and insulin resistance in Chinese young adults.
22640736 PDX1 repression of FABP1, LCT, and SI suggests a role for PDX1 in patterning anterior intestinal development.
22525507 Baicalin was able to enhance both L-FABP expression and activity of intracellular SOD and GSH, and therefore protected hepatocytes from oxidative stress.
22515481 Studies indicate the most studied biomarkers for acute kidney injury are neutrophil gelatinase-associated lipocalin-2, kidney injury molecule-1, IL-18, cystatin C, N-acetyl-beta-D-glucosaminidase, liver fatty-acid binding protein, and heat shock protein 72.
22465531 The present study suggests that genetic variations within FABP1 influence susceptibility to non-alcohol fatty liver disease.
22396741 Common variants of the liver fatty acid binding protein genes 1-4 influence the risk of type 2 diabetes and insulin resistance in Spanish population
21996226 in kidney allograft recipients, L-FABP may be a potential early marker for impaired kidney function/injury
21856370 FABP1 gene is highly transcribed in liver-derived cells, and regulated predominantly by liver-enriched transcription factors HNF3B and CEBPA.
21767383 Data show that IL-FABP mRNA was over-expressed in renal tumour tissue.
21757748 liver fatty acid-binding protein (LFABP) in apo, holo, and intermediate states of palmitic acid engagement;Apo-LFABP undergoes structural remodeling, where the first palmitate ingress creates the atomic environment for placement of the second palmitate.
21504508 Review: summarizes the findings on the pathophysiological roles and dynamics of renal human L-FABP in the recent experimental studies performed in a transgenic mouse model.
21356355 Renal hL-FABP reduced the oxidative stress in aristolochic acid-induced nephrotoxicity and attenuated tubulointerstitial damage.
21153750 Our study suggests that L-FABP is a useful biomarker for early detection of acute kidney injury.
20721681 the T94A mutant of L-FABP lowered free fatty acid uptake but had no effect on FFA efflux
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20575163 The serum level of I-FABP can be used for assessing the gut dysfunction and disease severity of acute pancreatitis.
20550918 the slow dynamics of human liver fatty acid binding protein (hLFABP) that was shown previously to be highly flexible on millisecond timescales was quantitatively characterized in detail
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20185732 High levels of the tubular inflammation marker u-LFABP predict the initiation and progression to diabetic nephropathy and all-cause mortality, independent of urinary albumin excretion rate and other established risk factors.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19622156 While B-FABP is over expressed in renal cell carcinoma in comparison to normal renal tissues L-FABP appears to be reduced in tumor tissue
19499240 two FABPs display differences in localization, regulation and developmental pattern.
19441025 Studies indicate that the members of the FABP family present in mammals that appear to be more closely related to the L-BABPs are the liver FABPs and the ileal BABPs.
19435794 renal expression and urinary excretion of hL-FABP significantly reflected the severity of tubulointerstitial damage in FA-induced nephropathy
19330863 paradoxically underexpressed in nonalcoholic steatohepatitis
19217864 study demonstrated the direct, albeit weak, interaction between MES buffer (2-(N-morpholino)ethanesulfonic acid) & liver fatty acid binding protein; finding of buffer-induced changes in protein dynamics offers a clue to how hLFABP accommodates its ligands
19019918 Urinary fatty acid-binding protein 1: an early predictive biomarker of kidney injury. (Review)
18854154 Knockdown of fatty acid binding protein 1, liver (FABP1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18838948 The results suggest that urinary L-FABP levels are significantly increased in patients with septic shock and that PMX-F treatment is effective in reducing these levels.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18506375 Data show that genotypes for the A-->G (Thr94Ala) polymorphism (rs2241883) of FABP1 was associated (P<0.05) with the prevalence of atherothrombotic cerebral infarction.
18506375 Observational study of gene-disease association. (HuGE Navigator)
18094680 Urinary L-FABP levels represent a sensitive and predictive early biomarker of acute kidney injury after cardiac surgery.
17826730 Hypoxia enhances the expression of FABP1 in term human trophoblasts, suggesting that fatty acid binding proteins support fat accumulation in the hypoxic placenta.
17698986 Observational study of gene-disease association. (HuGE Navigator)
17698986 The Ala/Ala(94)-mutation contributed significantly to reduced glycogenolysis and less severe hyperglycemia in lipid-exposed humans and was further associated with reduced body weight in a large cohort.
17605029 Intestinal L-FABP expression was investigated by immuno-histochemistry, western blot, ELISA and Northern blot analysis
17526850 These results have demonstrated that C. trachomatis can productively infect liver cells and utilize FABP-transported long-chain fatty acids for its own biosynthesis.
17485234 Observational study of gene-disease association. (HuGE Navigator)
17485234 there is a functional relevance of the FABP1 T94A SNP in hepatic fatty acid and lipid metabolism in humans
17428383 L-FABP may play a key role in the progress of invasiveness and metastasis in human breast cancer.
17003471 Renal L-FABP may reduce the oxidative stress in the unilateral ureteral obstruction model, ameliorating tubulointerstitial damage.
16945373 Observational study of gene-disease association. (HuGE Navigator)
16772708 EPO supplementation may ameliorate renal tubular damage, in part, due to a reduction of oxidative stress in CRF patients with anemia.
16249547 Urinary L-FABP levels appear to be associated with the progression of diabetic nephropathy, and NK 104 may be effective in ameliorating tubulointerstitial damage in early diabetic nephropathy.
16175609 L-FABP has a significant role in oxidative stress
15547295 Observational study of gene-disease association. (HuGE Navigator)
15308127 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15249972 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14563446 besides I-FABP, also L-FABP is a useful plasma marker for the detection of intestinal injury, especially in patients undergoing intestinal surgery
12121132 evidence that FABP is a target for tamoxifen and that target proteins are implicated in cell lipid metabolism

AA Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE      1 - 70
LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI                  71 - 127
//

Text Mined References (111)

PMID Year Title
26997447 2016 Expression of liver fatty acid binding protein in hepatocellular carcinoma.
26650609 2016 Association of single-nucleotide polymorphisms rs2197076 and rs2241883 of FABP1 gene with polycystic ovary syndrome.
26637457 2015 Hepatitis B Virus X Protein Induces Hepatic Steatosis by Enhancing the Expression of Liver Fatty Acid Binding Protein.
26585768 2016 Clinical usefulness of urinary liver-type fatty-acid-binding protein as a perioperative marker of acute kidney injury in patients undergoing endovascular or open-abdominal aortic aneurysm repair.
26439934 2015 Association of a Human FABP1 Gene Promoter Region Polymorphism with Altered Serum Triglyceride Levels.
26324091 2016 Role of new biomarkers for predicting renal scarring in vesicoureteral reflux: NGAL, KIM-1, and L-FABP.
26254248 2015 Urinary liver-type fatty acid-binding protein change in gestational diabetes mellitus.
26067610 2015 Urinary ACE2 is associated with urinary L-FABP and albuminuria in patients with chronic kidney disease.
26010898 2015 Distinct roles of urinary liver-type fatty acid-binding protein in non-diabetic patients with anemia.
25847235 2015 Fatty Acid-binding Proteins 1 and 2 Differentially Modulate the Activation of Peroxisome Proliferator-activated Receptor ? in a Ligand-selective Manner.
25797895 2015 L-FABP: A novel biomarker of kidney disease.
25732850 2015 Human FABP1 T94A variant enhances cholesterol uptake.
25663234 2015 Association of L-FABP T94A and MTP I128T polymorphisms with hyperlipidemia in Chinese subjects.
25516669 2014 Significance of downregulation of liver fatty acid-binding protein in hepatocellular carcinoma.
25436304 Decreased expression of liver-type fatty acid-binding protein is associated with poor prognosis in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25399315 2015 Is there an association between liver type fatty acid binding protein and severity of preeclampsia?
25370009 2016 Interaction of perfluoroalkyl acids with human liver fatty acid-binding protein.
25338211 2014 Association analysis of FABP1 gene polymorphisms with aspirin-exacerbated respiratory disease in asthma.
25324448 2015 I-FABP and L-FABP are early markers for abdominal injury with limited prognostic value for secondary organ failures in the post-traumatic course.
25198387 2014 Dynamics of a globular protein adsorbed to liposomal nanoparticles.
25027586 2014 Non-inferiority of creatinine excretion rate to urinary L-FABP and NGAL as predictors of early renal allograft function.
24875102 2014 Human FABP1 T94A variant impacts fatty acid metabolism and PPAR-? activation in cultured human female hepatocytes.
24750195 2014 Serum liver-type fatty acid-binding protein predicts recovery of graft function after kidney transplantation from donors after cardiac death.
24687388 2014 Nonalbuminuric proteinuria as a biomarker for tubular damage in early development of nephropathy with type 2 diabetic patients.
24628888 2014 Structural and functional interaction of fatty acids with human liver fatty acid-binding protein (L-FABP) T94A variant.
24626813 2015 Level of urinary liver-type fatty acid-binding protein is associated with cardiac markers and electrocardiographic abnormalities in type-2 diabetes with chronic kidney disease stage G1 and G2.
24554034 2015 Response of urinary liver-type fatty acid-binding protein to contrast media administration has a potential to predict one-year renal outcome in patients with ischemic heart disease.
24375576 2014 Kidney biomarkers and differential diagnosis of patients with cirrhosis and acute kidney injury.
24299557 2013 The human liver fatty acid binding protein T94A variant alters the structure, stability, and interaction with fibrates.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23893635 2013 Mass spectrometry and NMR analysis of ligand binding by human liver fatty acid binding protein.
23604313 2014 Elevation of urinary liver-type fatty acid-binding protein as predicting factor for occurrence of contrast-induced acute kidney injury and its reduction by hemodiafiltration with blood suction from right atrium.
23599408 2013 Performance of kidney injury molecule-1 and liver fatty acid-binding protein and combined biomarkers of AKI after cardiac surgery.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23349979 2013 Clinical value of NGAL, L-FABP and albuminuria in predicting GFR decline in type 2 diabetes mellitus patients.
23291381 2013 Liver fatty acid-binding protein is a diagnostic marker to detect liver injury due to chronic hepatitis C infection.
23223350 2013 Predictive effects of urinary liver-type fatty acid-binding protein for deteriorating renal function and incidence of cardiovascular disease in type 2 diabetic patients without advanced nephropathy.
23169100 2013 Evidence from NMR interaction studies challenges the hypothesis of direct lipid transfer from L-FABP to malaria sporozoite protein UIS3.
23167703 2013 Urinary L-FABP and its combination with urinary NGAL in early diagnosis of acute kidney injury after cardiac surgery in adult patients.
23144966 2012 Serum liver fatty acid binding protein levels correlate positively with obesity and insulin resistance in Chinese young adults.
22640736 2012 PDX1 regulation of FABP1 and novel target genes in human intestinal epithelial Caco-2 cells.
22525507 2011 [Effect of baicalin on liver fatty acid binding protein in oxidative stress model in vitro].
22515481 2012 Are recently reported biomarkers helpful for early and accurate diagnosis of acute kidney injury?
22465531 2012 Two genetic variants in FABP1 and susceptibility to non-alcohol fatty liver disease in a Chinese population.
22396741 2012 Common variants of the liver fatty acid binding protein gene influence the risk of type 2 diabetes and insulin resistance in Spanish population.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21996226 2011 Liver fatty-acid-binding protein in heart and kidney allograft recipients in relation to kidney function.
21856370 2012 Human liver fatty acid binding protein (hFABP1) gene is regulated by liver-enriched transcription factors HNF3? and C/EBP?.
21767383 2011 Fatty acid binding proteins (FABPs) in prostate, bladder and kidney cancer cell lines and the use of IL-FABP as survival predictor in patients with renal cell carcinoma.
21757748 2011 Fatty acid induced remodeling within the human liver fatty acid-binding protein.
21504508 2011 Roles of human liver type fatty acid binding protein in kidney disease clarified using hL-FABP chromosomal transgenic mice.
21356355 2011 Renal liver-type fatty acid binding protein (L-FABP) attenuates acute kidney injury in aristolochic acid nephrotoxicity.
21269460 2011 Initial characterization of the human central proteome.
21153750 2011 Clinical significance of tubular and podocyte biomarkers in acute kidney injury.
20721681 2010 L-FABP T94A decreased fatty acid uptake and altered hepatic triglyceride and cholesterol accumulation in Chang liver cells stably transfected with L-FABP.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20575163 2010 The intestinal fatty acid binding protein diagnosing gut dysfunction in acute pancreatitis: a pilot study.
20550918 2010 Millisecond timescale dynamics of human liver fatty acid binding protein: testing of its relevance to the ligand entry process.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20185732 2010 Urinary liver-type fatty acid-binding protein predicts progression to nephropathy in type 1 diabetic patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19622156 2009 Brain-type and liver-type fatty acid-binding proteins: new tumor markers for renal cancer?
19499240 2009 Localization, function and regulation of the two intestinal fatty acid-binding protein types.
19441025 2009 Review: the liver bile acid-binding proteins.
19435794 2009 Urinary excretion of liver type fatty acid binding protein accurately reflects the degree of tubulointerstitial damage.
19330863 2009 Differential expression of lumican and fatty acid binding protein-1: new insights into the histologic spectrum of nonalcoholic fatty liver disease.
19217864 2009 Buffer interference with protein dynamics: a case study on human liver fatty acid binding protein.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19019918 2009 Urinary fatty acid-binding protein 1: an early predictive biomarker of kidney injury.
18838948 2009 Urinary liver-type fatty acid-binding protein in septic shock: effect of polymyxin B-immobilized fiber hemoperfusion.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18506375 2008 Association of genetic variants with atherothrombotic cerebral infarction in Japanese individuals with metabolic syndrome.
18094680 2008 Liver fatty acid-binding protein as a biomarker of acute kidney injury after cardiac surgery.
17826730 2007 Hypoxia regulates the expression of fatty acid-binding proteins in primary term human trophoblasts.
17698986 2007 A Thr94Ala mutation in human liver fatty acid-binding protein contributes to reduced hepatic glycogenolysis and blunted elevation of plasma glucose levels in lipid-exposed subjects.
17605029 2007 Decreased expression of Intestinal I- and L-FABP levels in rare human genetic lipid malabsorption syndromes.
17536800 2007 Rapid data collection for protein structure determination by NMR spectroscopy.
17526850 2007 Effect of host fatty acid-binding protein and fatty acid uptake on growth of Chlamydia trachomatis L2.
17485234 2007 L-FABP T94A is associated with fasting triglycerides and LDL-cholesterol in women.
17428383 2007 [Expression of fatty acid binding protein in human breast cancer tissues].
17003471 2006 Liver-type fatty acid-binding protein attenuates renal injury induced by unilateral ureteral obstruction.
16945373 2007 Codon 54 polymorphism of the fatty acid binding protein (FABP) 2 gene is associated with increased cardiovascular risk in the dyslipidemic diabetic participants of the Veterans Affairs HDL intervention trial (VA-HIT).
16772708 2006 Effect of erythropoietin on urinary liver-type fatty-acid-binding protein in patients with chronic renal failure and anemia.
16249547 2005 Effect of pitavastatin on urinary liver-type fatty acid-binding protein levels in patients with early diabetic nephropathy.
16175609 2005 Antioxidative function of L-FABP in L-FABP stably transfected Chang liver cells.
15547295 2005 Intestinal fatty acid binding protein and microsomal triglyceride transfer protein polymorphisms in French-Canadian youth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15308127 2004 Plasma concentrations of apolipoprotein B are modulated by a gene--diet interaction effect between the LFABP T94A polymorphism and dietary fat intake in French-Canadian men.
15249972 2004 Effect of liver fatty acid binding protein (FABP) T94A missense mutation on plasma lipoprotein responsiveness to treatment with fenofibrate.
14563446 2003 Intestinal-type and liver-type fatty acid-binding protein in the intestine. Tissue distribution and clinical utility.
12646418 2003 HNF-1alpha and endodermal transcription factors cooperatively activate Fabpl: MODY3 mutations abrogate cooperativity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121132 Identification of two tamoxifen target proteins by photolabeling with 4-(2-morpholinoethoxy)benzophenone.
11461829 2001 Ligand specificity and conformational stability of human fatty acid-binding proteins.
11354243 2001 Expression of liver fatty acid binding protein alters growth and differentiation of embryonic stem cells.
11226238 2001 Fatty acids and hypolipidemic drugs regulate peroxisome proliferator-activated receptors alpha - and gamma-mediated gene expression via liver fatty acid binding protein: a signaling path to the nucleus.
10684629 2000 Binding of fatty acids and peroxisome proliferators to orthologous fatty acid binding proteins from human, murine, and bovine liver.
9688651 1998 L-FABP and I-FABP expression increase NBD-stearate uptake and cytoplasmic diffusion in L cells.
9250612 1997 Heart-type fatty acid binding protein - involvement in growth inhibition and differentiation.
9070383 1996 Intracellular fatty acid-binding proteins: putting lower vertebrates in perspective.
8232272 1993 Mechanisms of regulation of liver fatty acid-binding protein.
7784447 Fatty acids in cell signalling: modulation by lipid binding proteins.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
3838313 1985 Human liver fatty acid binding protein. Isolation of a full length cDNA and comparative sequence analyses of orthologous and paralogous proteins.
3838309 1985 Human liver fatty acid binding protein cDNA and amino acid sequence. Functional and evolutionary implications.
3012800 1986 Human liver fatty acid binding protein gene is located on chromosome 2.
2824476 1987 The human and rodent intestinal fatty acid binding protein genes. A comparative analysis of their structure, expression, and linkage relationships.
1699834 1990 Liver fatty acid-binding protein: a marker for studying cellular differentiation in gut epithelial neoplasms.